SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001015692 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001015692
Domain Number 1 Region: 402-575
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.31e-24
Family cAMP-binding domain 0.035
Further Details:      
 
Domain Number 2 Region: 286-432
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000000314
Family Voltage-gated potassium channels 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001015692
Sequence length 1099
Comment (Tetrahymena thermophila)
Sequence
MNETSENKNHLHTNQQLFLKERETDDAFKLRQKNMSDDISIWTDSSKNSANYNADFQNSQ
EYSKSINILKLKQNSQSIQQENSIFFNEEDITQYKEQKFNNDITALSKKNNISTIKSVYK
QNLMSPSKNCNINESKMEISQSTMNNKHQTLKNCRQYTTKVLSNHIKLTIKLKQKFSYFF
KAFTMAGRSQALNSTIRSFINDKSDRLGQNSKISAYLRSIFWIQIFQGFLQFHAIFCKIS
SFLWVIEIVIKLNTSIYINSRQVVERQEIIFCYIVNIISELNQFYKFLFRVVRQYYLIAL
INLIIKMFLIAHILACLWYLLALYEYDQNLESESWIKKLEIEGVWWKLYFQALYWALTLM
TTGSNEATTNLQRIFTSIIMIFTAIVFGYLLNVVGFILEAIDEKNEKKRRDINILNEFMR
SKHISQSLQARINLNLENYYDMNFNKAHKKSQQVLDKISIELKNSLMKEFNRKLINKITF
LTKNFSQETLDKLSLVAKEECYLPSQVICNLSKNHDSALIYVISGQAEIQRTNKDQSYVD
ISNLKVNQGEIIDPTNLFTGLSQPFQAISTQFTQIKDQIQYYQLNSVIGLKCKFCCQSTH
YIYDCPFLHFGKQMIYSKIGLKQKQEQNRQHFERRTKYMRTLLIQNTDPTLLQFQEDHQF
SKNKETLTSIGVTILLNDDVATNSEYDDKQNEEILQQRIEFTVIEEDDEKQIDYSPSIRE
LNHQQQSPILTNNLLNSLKTQRINTFTQYLEDQELASPVKIQLSETQAKSSRESYKQLKV
NTHKRFNSLQDNSKDTKNPEQEVNYYYQKKSLFSQINSDILNRQQSTQSINESEDSKQKN
QKKREYDQHKSNEQEYVQFNPWEFDQLKDWNYYFKYGNSKYVLLKHNKYQQMKAKQILRK
SPYKRKYEISNKNLFQKQSLAIQIQQTTYSLKPLSLLSWLQEDHSPSLFIKKKQTLFMSI
NDFINDHSQQGILLKLQYTEDSKQLKFRNEVLSDRIIWELPAHQEQVAQSQTNRDIDLSK
QESQNTCNQNQEQQKSRQECDDINKTYLFKKININQNILNLTDQIEGLSEMSPSCNECQT
YFVVVQLHQKGKAQAINSN
Download sequence
Identical sequences 3828.m01358 5911.XP_001015692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]