SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001016408 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001016408
Domain Number 1 Region: 475-664
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.96e-31
Family cAMP-binding domain 0.018
Further Details:      
 
Domain Number 2 Region: 253-472
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.67e-22
Family Voltage-gated potassium channels 0.0037
Further Details:      
 
Weak hits

Sequence:  5911.XP_001016408
Domain Number - Region: 668-695
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0288
Family Retrovirus zinc finger-like domains 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001016408
Sequence length 1080
Comment (Tetrahymena thermophila)
Sequence
MRVESINQNDINPQQSSSYQLGQDNNTYSFYQFKISKLQQQNQSLGDQSNSQQFLPSQKF
LNQTRNEQDLITEEDKRENCISQKDNQTDNSFVAVNLEETLYRFSDQCPKNISENNTIFQ
EIPKVDAESQKMTSRKRNGNQLLNQDKQKARSQSVSTQFRKKNNQILGNDCQSIIEKKDP
NKIGYYQRGYKKRNNLLILDLYAQKDIWKRKWIQILALVSKVKYIAQQSSLFFRPSQLRE
IQYLPLFHNLSSLYILWEVIIFINSSILFVYLPLEYCFNLQREAIFSYYIQYICSIIFSI
DIFIKFNTLSTQQGTFIEQHIQIFSSYVSSSFLIDLIAILSLCCFSFSFNGIQFLFFLKI
FQAFRILETIREQFLLKTKIFGSVIYFAHLFTCLWNYVGIKELDQNEGWMVTYSYQNETV
GSRYIQIFYYAIVTMTTIGYGDFTAQTKLEKFLMIFIAFFSCGIFGYTINSIELAKINKY
FKQNNVELGLQCRAKKYVQYLYSDQNSDNLCSIKSLSALSEYLQKEIQTDVYIKILKKVP
LFKDILTEEIFIDLAMQMKEKIYCHDQQIILLEEDVEDCIYFVNNGIVLEYFQYDQTTEV
KEVQQFKYGQYFGLLRFLQGDNNCNVKYKSVGVSSILQLNFTDFANILRKYDLQYEKFCY
IKDEVKYQNKLQKVSSCCYSCKQKNHKIEECPYLFYEGKKNLILRKYLKEIEFKLKNFKR
NQTEKSMNAILNQNIISHQADQYYIQNIEYFSLWDLSQESDYEEEEDEEEDFLVKQTAQQ
DRDFNGINVQNSESIYKDQSPDDQQNQSLKDSQSLQDQYENNLSAQKVFLMSNLLSRQTQ
DDDSITIEDSQYNPANLKKKNYSSKKIKTFDSNINFSINLDQEMIYNQQSLTKMHTYGKQ
DRQMEVSQISSNNKLQSLQVIRNIEQIIQQSNHTVSNCQIPNCQTCTKLKFMIISALKKI
ANTENQKLYPSIRASSFLEPKKKSSLFCIREKTGSNIQLQQNNSLNPNLNRRQCSSFNRN
LTNNQSKIFSRQIINFSDQLFYYDFDKLKTFEYYFPEGNAQSIIEQYSNIYQNKNILWMM
Download sequence
Identical sequences 3699.m00220 5911.XP_001016408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]