SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001017338 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001017338
Domain Number 1 Region: 374-575
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.62e-37
Family cAMP-binding domain 0.0075
Further Details:      
 
Domain Number 2 Region: 264-409
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000173
Family Voltage-gated potassium channels 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001017338
Sequence length 884
Comment (Tetrahymena thermophila)
Sequence
MDPQENYEFLNKRKSQMKKCLQKDSQLDVLNMRIEESCQSELDQIPTDVIPCKNIQTQQM
SNTTSQYDEQNFTVFLNDNFNETKYKSHSTKFTHFKPNLLLNSSSKPMNQVDFQKVDNTK
CKILNRNNQNDDDRVQDNYYLGNGKSKELVTLSNIKNKMKKYFREKTYVGKSFNLQNPKL
RQQINDKSDIIEEQDNIFQQYCGFMDSLTELLYQKINNLPLFNPQSYLKFGLDIVFSLIN
CFFFFYSSILIVFQVNLEFESQIYNTMYLIWTLQIIFIVAHIIACLWFLVGYIELEYLGE
EKTWFDESIAASDRNWVKLYICSLYWSLTLMTTGSNEADTVLQISFTSFIMLFTTIIFGY
LLNIIGIVLTEFDQEEENQRRDINRINQYMRKRSISKNLQRGINLDLEYYYHHNFKKDDD
QNQTVLSKISVNLLQELKKEYFGKFLNQIDVIYKNFSQDTQQKLLLYLEEQNYLPGQVIN
NYQNQDESRLIYIIEGKVEIVRSYSDGSDIEFVIDSFGKNKVIGQIAFFQGRQDGITIKA
VDFTQVISIPRNKFLEIVKQNDLDLQNFCRIKDKISFYQDFEDIKIKCENCNSFNHQQYE
CTLLHIDKQTEKVIANYNYHLAQFRQNYSRKSKFQSNALITQQQTQNICKYICNECDFQE
ALVTSTQLKNSGSINEGLAVSEQEFDPLSNNMKTLRSHSQINYEEEENKPHSQDIIKKKG
KGIIIKKNSQQIFLNLDTQVSNCLQDECDGSQKSIKDKLHKETSIVSKMLDGSTPQTAYH
SQNTQLTFKNFLKEITQQCLKKLSRLENIIKVLPGQQIVLGKQQNQSSRSDIVQSVGTDK
IIWEFDQKKDYTIYFPHGNSDKIIFTFNQKLKKNTLKSLKRKKK
Download sequence
Identical sequences Q23KM6
342.m00029 5911.XP_001017338 XP_001017338.1.55412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]