SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001017435 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001017435
Domain Number 1 Region: 554-742
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.83e-35
Family cAMP-binding domain 0.0093
Further Details:      
 
Domain Number 2 Region: 419-589
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.63e-29
Family Voltage-gated potassium channels 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001017435
Sequence length 1343
Comment (Tetrahymena thermophila)
Sequence
MFKELQIIQQEDLKGQKNEEINILSDMNYQMRDSQSLKSQYQFDNFLSVQTENQDSENMK
ELDGKEKNDFNNINEINAFSPLFQQCFDEDLNMKDLIPKIDLNKDGREVRQLETLFTQED
EQMLEKNILRQDQSNKIRAHNILTQKSSDQNSICLSQQNQLFDLELKNTQDSKIVDANSN
NIRNSYASYNLSQLTEKIRNSIIKNRKIQQISPNFQPENKSKKNSLINFTGLDLNQKKSN
QSNRKWNVAVNLSTALRVKQKLKSFLPQKFSKVSQYELTLIGDASYMNEKNNLIEINHKY
KLLSDLISHKFHPESMFVIIFKLITLIITTLNIIIIPMIITFNFQSNQIFSTFYTLSLIV
FFIRMIIKFKTAIYDKGEIIYSSSLIIKNYVKDGFILDVISLIGYVLGIYSSYFFLFTFL
RVNNIMKLMDDINNRFYLTEKYQKFWVLTKLFAMIILMNHFFACFFHYIGNYFQNDPSDT
WIKTQGLDSCDWIQRYTEALYFSFITCITIGYGDITPKNDYERLTVIIFSCLSTVCFSYS
VNTIGSILQDYQNKYQKYIQMRYNAIKFMGNRKINKELQMRALKYIEYIQTIEEDSPENG
LSVIFSDFYGKILSQHKYFALNYSKQTINKLSSRVQEKLFVPGEVIFEQGEQDMRLFYLI
KGECEYYLQNKGGNKHSQIQSIAFTNEQNFFGYKGFISGIPREMSCRSTNITHVFYISRD
DLISVLKEDPLDYEQFCKVRDQYQLYTSSLGEQCFTCKSYKHTMIQCPKIHFSKNRQLLM
YKYNYSADQIRQYKKRKCLKYATILNMDLISFCAKKYRKNITTSLNRQRNDAPNNKFNEN
YQECLIPDKIYSLQYPYVIQQNHEISIYLIIKNKVKFQGQTFKDIKLYDNQDLDSDSFSD
SDSSYSQSSLPSQQTINEDQYNEDLEENDDDQDDFNNQKQLFLQNSKKSSQDQENKQLQS
NDDIDLFQENKIKRNNFMQRKLSYSPTKKKSSSPDRKKDSHQNSQQKQEEGEINMKKKLF
TKQVESKNQGDIAKKINSQNKINSLEDLEKQQCNQQQNNSSNPTSFSQMCLSKKSSKQRN
LNDQNKNQKQLQKHHIEFNIDNISIQNWFESKKSYKSQKSQKLFDRSDKPGSIESLQNEN
KLYKSMSHKMQEKCNIQKQQIRRQKAIKSMTLLLKQNSYKEQKQINNNINELHLELSKQK
FNQILEKQNQFMQQIAKSIQQLQESQKNNILNLADHSASQHEQNSKDNEQMKLHRINVKN
TQQIDSDLFFYEFDSVKEFKKYFPYNNASSVCQSLKPKVNQNQQINNQRYSFLSKRSIYQ
KKNSLLLKSKSEFYKQKQQQDKE
Download sequence
Identical sequences 3719.m00084 5911.XP_001017435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]