SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001018444 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001018444
Domain Number 1 Region: 469-652
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.06e-40
Family cAMP-binding domain 0.0058
Further Details:      
 
Domain Number 2 Region: 246-456
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.44e-19
Family Voltage-gated potassium channels 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001018444
Sequence length 1217
Comment (Tetrahymena thermophila)
Sequence
MQNLNTLPWDTEHFNNKSIQRKIFEESVSYHLKGDDDNFDLSIIDNPTSLRASDGILSNR
IVYQDVQSQEQQTHQENELEKFQHKSQKSSLSHKLTENSERYQQVGVLDHPQKLKINERK
SSFKEKKSYLSQQEQDNPIICSLDQQSNLFQISKMSINQKPSELDQSYLSGIEIKHSEKF
MQQSNLEYIQPKIQAKKESIYNYQKAADIIHYVIGKSANRVQRVDQQIKNFIAILKSLKQ
NRRLPIYWNFFQVFFIYTFLYIYSILLFFCSNEQDSISIKQYFKIAFILFLLDIIVNFNT
SYFDKDTIIKKRKKIAWRYISSSIFLTDAICTIIIGSKIIFDANFIYNPNSTLIFFVNLL
LFSKLNGSQEKRNSSYEVENGYQVSWLQKFNLLEQTYLEKYIYSMYWSITTMTTVGYGDI
SATNYVEATFILFSMILFSCMFAYSINNIGFILQEIEKSSKQVNDSITTIQSRVRHYLQF
LAKEQKDRNLQAENSVLKSLSKKLRDEIAIEVNQRILKNYSIFQTNFSQQTLVKLTFIME
ELQISPNEIIFEQGDSEDQSIYLIESGVIEIYQLLPPYSNINKLRDNNNSHILKQLKKKD
LFGEISFFSGLARKSYARSLNLSTLYKIDRNKFIAILKENNEDLERFKMIEEQIKNVIAA
NYKDIQLTIALSYIKNLIPNFKYLSITLASTKTDKKQIEERINNIQSQKLDFLTSASQKD
IVKNDQEDYQTSTEESSESLEDDKQQNKSVFQPDKQKSLIQKRASERQQKNSIMQNSDFA
ANLLQNENVEQISNQVMFKNQQSIKTIQNMNIEYAQSKSFSNNEYASDTQKTDTENEFQQ
EEVNQGIQNQEQLLPSILNSKTLVEIQKTNSNIKLASNLSSTEINLKSKKQEKKNSKQVI
YQSKKRISQDDCYSNNFSDEETIKPIQNSSNKRKSIKIKVGTKKDLQEQLSKTSFEILNS
LNGNFLKNLVYQNSQNTIQTINAINMQEDAIDDLSKINQDINKLEQNQYSLQQIKQNHSQ
KSVNFNVNQNDQNENNFLCKSLKVLGIPSQMILNTSNQKEILQQIEDILRRSKKDITSLS
KYSQRLIDEQQNYHNFFMNDFDKIRFYKRFFPHNNFSHIFNNTNLKKLTEFKKIKQSKTF
ANKGRRNNILKTAVPRKSLFCNIALLQNNFPSEINLDSYKPTFLSYGVCCKDYSIFPKSY
QNNIYLNEIFKQQEQQN
Download sequence
Identical sequences 5911.XP_001018444 3695.m00072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]