SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001020203 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001020203
Domain Number 1 Region: 581-789
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.23e-45
Family cAMP-binding domain 0.0022
Further Details:      
 
Domain Number 2 Region: 461-620
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.77e-24
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001020203
Sequence length 2040
Comment (Tetrahymena thermophila)
Sequence
MLSENASLLGMQGQLTTTNKDNIQTLLTQQNTEREKDLNTNQPIKNENPTVMSPSIKSIN
KGKNNSDKKNPPAEKHGRIKLSPIENIKQDGEGHEFTLDQQSNYFKSGRKIRLSIQQQQN
LQGGQAQAQVQVQGAISNQSSNFLVSPSNTFLNKENEETQHMIDAKLILEGGQTSRAFIQ
KNDSDIYQQKQGNHVIQEETPNILVNTQSVRSIPSFMEKLTLKSKTKTFSSFLPTIFSKQ
GGLQKLSTIVPEKSVESNLSKMVRFVKLKKQAVEMKRFFVKSQHYKNIMTQFSNPFFKIL
DDLSANSIDNSNTTYFFLHLIRNLKLYQILVKLIKYIPVIEPSSKFKLVWDLLIGTVFMT
YFFIIPIHVAINVSIHDLITPYVGYTLHLMMLIDILFSMVTGYFEKGVNVNNKKKIFIYY
IKYYFWSDAIAQIPLLISELGNQDSQVEKVFVLLFFVKLRNFQKIFRKFEDSFHLTPKTS
NIISLIKLILNILFFSHIFGCIWLFIGLQEYHLNQNNWMRKIGMEAAYYFSTVTMITVGY
GDIVPSNNFERVASVGTMLISCVIFAYTISQIGQIFSDLFSQDRQMKEFFYIINDYMDNK
NINFSLQYRIREYLDYYWREQDQNKSDLEKKIIDSLSDNLREKLMVEANRIVFKDYGIFS
ANFNSSIILKMIPIIQILHTTPNQIIFSEGQSDDDMFIYFVEKGKVEICREYNSENNEGE
KIYKKIVSLGPGACFGAWSFFTNQDRKEMARSLEFSKLLMIRRSDFLQLISDMPQEMEKF
NNIKDAIIFENNQEFLEVKCQCCQSYNHEIQHCHYFHYSPDRYIIIKKDNKKYLYQHRDS
KFYRKRIVTFGYFTSSKEQNIAAEKWRNQNTETMDYYYQQYLMFDELYGEDFSQDDEYDE
DALKYNSSEDSVNENDEEDTETYYDEDNSVSINSKKSNKKKYDSVINEEGENEQNSSYQI
QKNNTISQMNQELNMSIVNSTEIQDVGQYAMQKSYQNQEVEEDQDHVRQRKRQITSIFNK
MHLSKLVEQDESLPSQNNITSEKGSSGLNTRKFDKILNSLGQETRDECQRSPNIIQKKND
SNQQSNRSIKMEQSITGKNNNENLNSSDANIIKRAGFKQLTVMTNSDLGSIRTINKIPIA
TNLSPKTLKKQGTLQMHDREMSIGCFSDQEQSPQLLFIADLDNFDLSKKSSKQEPGKDRL
ILDSRNQIDDFNIEKEEKSTTKNTGQIMKQPREIMDSQQQNISSKQNQQQNLIPNIKELA
LKNQESSNNPRKIKKEKSVKINSLNEEGLKRKSSQRSQTLISNSQSEIKSSKRISFSNIA
DGFNQDINSKRRKSNKSKDFNELFQKASENQNKLPQEQQSPLKRRKEDQLSRERRKSRTS
QNGLEMIRNITLTEQMIQNEIMPNSDKNKRKSCQNRFGEYEIKHSEIQNTFSPSIKRRSI
EKIENLRSQSFKNLGIFASKSVNNQVGKQGISMVQSHQPQKLIHLIQNQENSENGKYFNN
QGNQQIINLNKNGKKISRIGQNLINLHQNEAQFEDINHDKNIQSNKDYKDSQVSEESTPY
GDHDDKGKKKAMHSKDKQKGKLPSQSSFKKNKTNMTTQDTQNLSPSARNPNFLFPGAKNQ
KQDVNSPLSPMPSPRQTSHVVKNNVLNFIQKAKIASQLNRSNNESISSQQKSRQGDQSPT
SAISIKKQQLHNMNLINKIESQEEFNFLQRKNLIDQQNILNQRKHSGNGVNMANSISQFR
QNYLGVGKSGFKMNEMGTPLMKGSNDTIKNTHSQYQKQYSNIKLQLLPQLSSSNYDQQML
NNNNLINIVPISNQSTQFQNLQGSNLQLQQLQLQNQSESANYQQNENDLETLFTIMSFDE
LKQFQHYFPKGNYLRVIAKANKIIGKQFSKLIKALKKQKANKQRKDDQNIKENRRGSYLQ
KKQILQKKKSNGFETPNVGKQNTKNRSGSDEKIGTRNRVNSFALNRNNLEESQYSQGSDL
NNNKHSQKDSPQSKEFIPIKLNSEIIDKNIQNIVNLAQFDSKKALSPIQKSIFNRQNPQF
Download sequence
Identical sequences 162.m00070 5911.XP_001020203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]