SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001023292 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001023292
Domain Number 1 Region: 579-725,755-815
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.22e-27
Family cAMP-binding domain 0.013
Further Details:      
 
Domain Number 2 Region: 452-618
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.14e-25
Family Voltage-gated potassium channels 0.0031
Further Details:      
 
Weak hits

Sequence:  5911.XP_001023292
Domain Number - Region: 845-871
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0034
Family Retrovirus zinc finger-like domains 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001023292
Sequence length 1390
Comment (Tetrahymena thermophila)
Sequence
MRQVSKIFYIKRENSYIYEIQDQGALNRREYFVSSMAEQKRYKKSSSSVSSIKDVKYEDS
NYAQSPRQKDVSLIQNMLEKTNTITKEKQQSMLRTSQLISSNNCNLLSPSQLTAIEVKKT
QSQEQQALITQEQKYSNNYNRSIIQKKTFLQESRTSQEFHPINVDLTKYNQKNIFSPQVK
KSPYSDKIDLQSSAIYYDVNQFKSEYNYRKNYLVIITYMKKIANKLLLKLAYKDNRLLNS
THLTIIRDKAIVDYQSYFNELFKSQKYVYPLKFQDHLLDNKKNQILLRNTNTNTQKRNTN
IFVFILKIMISALKQANDIVGVISPNSVIIAIIQVIIVLLIFYFIFILSIQSCFLDYYQQ
QIDEIQYIYISGIGYTLIDIYIGFYQGFYEFGCVQNNRYQIACRYLKKRFYIDLIMLNCY
IFNYLYQQNISILLTIIFSVIQVNNKVKQINDYFKLSSRFPFWFDILKLLVTILIIAHIC
GCGFYYVSVISQKSQFDQVFKDGNFNWIDFQGLTNSSWQTKYVYSLYFSVITMATVGYGD
VFPVNINERIYVIAMTFVSCGSFAYSINYIGQIFTQIQQQSQSFQQKQYDLLNYMRLKHI
SKETQTRILKYLEYLEDKTDQIAIKGKITMITIILLLLQNKQGQQILDDYPPELRDEVMK
ENFLKLLNLAPFLKNTFSQNFLLQLCLKFKEKRIGPGEILVRKNQKLEYLYILTKGIAEY
VNFDGVEKLPLYQIKVKHQQNIFIFKNLLNYLNQQKKNIQNEQTLIDVRLFFTGIEADVS
IQSKIVSCVAYISFEDFYNVVKQFPSDYVNLFQIKIILKIYFFICQYFKQEVFCMLKDQF
LNDSRQYLQCQSCRQIGHSFINCPQLHYDLDNQLFLQRQIKSIPQQRFFQNRSRQKKYNS
VFQKFITSQNLKLFRWTLVQKYLQNYNHIDPIAEASVMENEKQFYRRCPKFNLQYFSVQS
QIAIERKNTGDLSSESQSECSLSSDSFTKSSQSSNKSPSHYTQSLFSEQKLKSPLSEVSI
KSHDNKRSSRRTHTLKRKTVELENQIVTIRDIPINDSQQDNTIFNQEVENQKQLNLESLQ
KLDTMDRSVDNFAPDIRIQYFQKNSHKKNSQIFEGKQCDDQNTQTNYSFKASTKNKSDTL
KIQTSDIDNKLNEYQQQSDLKNSINCHVQNLLSQNLVFQVMQKIVNDSLNKTKKSFSHTS
ISYQQQESMDITKDQIDSLQKFKKRQNLLTNNIIFQNFKRIPSINTNMQKQDQQISNNKE
VQKGESHIFGKLEFSFDRIQEFEKYFPKNNWTKVIKSYKKQNIIEKIIQAKQNKKMNKAT
QKIKFIESSKNFINIASPSPASQFRCKIQKLKQNQNIHFIQIKQQIRIHQKAKKVFCQNE
LNLHFSQYFI
Download sequence
Identical sequences 3704.m00019 5911.XP_001023292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]