SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001023302 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001023302
Domain Number 1 Region: 681-865
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.95e-37
Family cAMP-binding domain 0.0038
Further Details:      
 
Domain Number 2 Region: 436-681
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.92e-32
Family Voltage-gated potassium channels 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001023302
Sequence length 1368
Comment (Tetrahymena thermophila)
Sequence
MLNINNQDFLDNTFKKDQQSDSVFNDFYQSQQSKMSSTNQIINEKQVQGPIFSQTKFKKD
IDKLGGKQCDEEVMFSPLQGIEKQLKFNQKKTISSKHLTSENEQKTDEHQIIIKRNSSGS
KSFLVSKNISVKSLHDEQNILQDSEKQIEDLNDSFDLTDNRQIKYERDFSASTKNRTQTV
KQQNQNTQQTSDEQTNIVQGILSLGVGSSNHKKRGSAIFINQNIADQRKHSIFSAYHSHD
NIQFRYNDSLSPSKLAINDLASKGMTSEPGTPTVSIAKKARNYDPGAQMQLLNLKNASGY
MTGDLTNAEKSLGDMSFKKQEGFKGTWKRNAFLIITFTKKFINNLKELTMSYKFSQMKQH
YFELIDDKANDYKYYQIHDQFTNDQPNQFQIMLYKMKAIFNKNLYVNQQKNEKKKNQIKL
FLNRIFNIDIPIIKPDQYIKIIWDCFILFLLLINLLYIPMKISFSEVTQFNDYLLIFFDD
LPSWSFLVDVILNFNTGYYSKGVIITERSKIFNHYIKGPFWRDIIVVVPFLFSSVMNVKF
LNIILLLRTNKILKIQRSIEELLNLQQFQTSILNLIKLILTIIYIAHICGCFFYYMHVLQ
VENDIAAFTWVKKFGLQNQSWFNLYITSVYWAVITMITLGYGDIYPVTLIEKIYVIFVTL
LSCGVFAYAVNAIGYIIQDMNRNSTQFKMKVKKYFQYLHDEQNEDNEDGQKLLSQCNSTL
KNEVLTEMYGQILESRKEFRLNFSKEFIQKLALKMRERRLGPEEIIFKENEFCRRVYFVM
RGNVALQRTRTINHNNQEKQKEINMKILKKGDIFGLESFLTGSETNVCAKAQNVVQLVYL
RDEDFIQVIQEFKADKEAYFMIKDKLNLLKACRGSGISCTLCDSFSHQFLNCPYMSYQPN
QRKLFIQYLKEQTQERKKYERETKQQKYPTKESLSRTQEAFIRLVFEYNPYETLNELLEQ
IQILDDEGALDQIDTPEMVTKYMKDPQEFEDIEDLNDEYEIDQYIKNSNEAQSNNNLMKE
NFDDSVRIRRATVESLNTPDQQIDIINGGHVYNTFIRHSSLKMNKSDNIQLEIPRREERK
SSFRKQTQFSAHDQVILINQDDTTPKRMRMINNSDNSSMKQINSENIIQTPLLTHNVPNS
PQLEKNRQFYRNYRSFKDDDESLDKQYPYNNYGPNSQVSIYQLDNNIRTVSIKSNKSHHY
ESKREIEINQNTNYAPPGSSMVQQIKDFTTIQNFDKAHQWNVYLPHNNFDKVLSQHQALL
EKILKEKRKRRRRTNRNHSQKLKQMQQLFSNIQAKSQQKNNTKILTRNQQSKQSFVSHKE
SSLNPISRNQSQLILASPRNENREPSRSMLSQMDFPSELPIQSSIQHY
Download sequence
Identical sequences 5911.XP_001023302 3704.m00029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]