SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001023760 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001023760
Domain Number 1 Region: 534-667,705-768
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.46e-37
Family cAMP-binding domain 0.01
Further Details:      
 
Domain Number 2 Region: 400-558
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000153
Family Voltage-gated potassium channels 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001023760
Sequence length 1173
Comment (Tetrahymena thermophila)
Sequence
MNSSKKSEFAERQNKSMVFNISEHKELNMMNMRKDTPFSVDNSERYDENADSSKHSYHFH
QNQGGDSSFIKSLDMQKSQKQDIGSSMHIDDKISINTINLDKKQNTDKDMLGGLKFLDNP
NTQKSNVSMSFLRSRSNNTNLFKIKNLGIINGDTKNNAHNDSSMHLGATPLNEDIFKNKN
LNGGDDNTRYMVKKNETTKKFQTQIRMVTFILPKMRKFLETKTFSGKVRYLDSNIRMYIN
DLSDDLQFLMKRKLNFSFFFNILIEFILLILRCLRIDKIPLINPENPIKLIINTIIVAYN
CFYLFIMSVEVFFEAHFGSYYNIFNSIATFCWISEMLIQMNTSCYHDNKFVTDRKVIMKI
YLKEYFFFEIIPILFEGNKSPNNLVNILLHLPLLLKIKGMMIILQKLEFYILQVLQRPYI
LTLFKLCMQVVIFGHIIACSWYSLGLIEEHFMEDDECWIQNINQQHLGDANATLPWQTYY
LEALYWSFSQIVHNSQEKPVTLLELAYSSTIMLLSSLLFVYLLNSIGEILNEIDKQNEEY
KKDLNILNQFMKRKKIDLSLRRRANLSLLNYYQQQSKDKVGQEKEIINKLPEQMQSELLV
QSNQKLAKMFPIFYDLFSEDTMVKLYSIMEEEVYAPNQIIFNCDAETLNDNIYLIIKGSV
VLYIERGAQGIVRGQENDDAQKLLSNNYIKSEVNINMKKNVQNKKDLVTLKDGETFGLHS
FITGTDKIANIMSKKYTHVIKIQRSLFLNIIKENKEDFEKFMELKDKVYLDKNTKIGKKI
ICYVCKSQEHTFSECNKVQFDKLNPYIIFRHLRNTDQERSKGHHRNPLRSTNSVSLQRNL
AYHILQYQEMNDFGSSNCEDYTEQTQSSYYEQQMSQQDMYSKKYEVNNQSIEEKQNSDDE
TSINYKMGLSHKNNGNNTNSEYVMESANSLKLQKSLKRRESKTNPAGANTPLETFSVAPN
QIYGDQLQNQVIETFFGSNAIKEDEEIDYDNHIINSPPRAKKSPAPIQNDRAPLSPQLYH
SDDNLNRNQFGMGRESHSDRNIPHSSKLISTNQNIRRGSNNNNGRQKSDSQHNIQSAYGK
MDIKKSESKHYHSSLDPTSQLYAQKNDKQGASLLHLHEAGKKDGPQTYMRQGNTMIEQSQ
VNTQRWTKILIFGKLTNSKTLPITSNTIICKMS
Download sequence
Identical sequences 5911.XP_001023760 21.m00257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]