SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001024050 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001024050
Domain Number 1 Region: 469-672
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.49e-30
Family cAMP-binding domain 0.013
Further Details:      
 
Domain Number 2 Region: 352-502
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000581
Family Voltage-gated potassium channels 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001024050
Sequence length 984
Comment (Tetrahymena thermophila)
Sequence
MLQVKSSENVLQVKLSGKNSQTLINISKKADSFIYDEEAHQNNTNRLNIAELSFGGSIEQ
SNISQNNSIIGFKNDQDENLLKNKSQNYCKYIINNETATDYVEQDLRNSQKIKNVGSPIK
QNHTRILQERAIDKIQKAEFSKTQQLSINNAPPAQIDEQTKIISNGLNSIDKVIRIITFI
KPQVLKFFENYTMSGRYRQFNLDSRLLVNDRIDFSQYISTKKPSFVKQILNAFYSVFLLM
IDTFFLLLIFFEAEFEGLFEILSNIANGAWVFEMLISMNTSTYHEGEFVTDRRIIFKIYT
KEYLLFEILPLIFDGKSSSNITLDILYKLPLLLKLKGMSIVLIKLEFLILQHLKKHYILL
IIKLLLQILLLTHLMACSYVALAQFEMHFLNIHNTWINQSQLMVSEYKWWVAYFEAQLWA
FHTMGNSYSISVSTQLEYAITSFWMLISCVLYAYLVNTLGSILQNINLNSENYKKDLNTL
NKYMQRKKIDLELQRIMNIHLQNQYEQQLQVQFDQEKETLNKLSYHMRNKLFTESNKNII
KQFSFLKQFSQQTLTSVYQIMQEESYTEGLTIPTFDLNSQDSFLYLIIQGSEYQNEEKKK
SADYQKKGQKVVKRLTVGQTFGEYEFFANSQLPYKIQSCKQTIVIKISLKQFIQIVNQNK
QDYQIFMEIKHKVQLNNEMSIIKTNCIIQCLQAHLPKHPQFTIFKHTYYPSQERDTNYKR
IKSKHDRCLIINTSEQKQLENEFEEDVTSIDQYTQDKADPNQNDNKQILYEVNRIRKKSR
MQESLKNIEEQMQADQIQIGIKSQEFKNSEVWDIKNNIDGKNNSDINNNMNISCKKKQIS
NSKPLIKKPSSNVHNMDNKISSEQQFSQFETQDKQMLKGSNKVIEQENQTAIFSHKQEYK
NSDKNVDTIISFTNKYLEPSYKNQIQNQAIIQNNNHRIVFEEAFYKDKWDSSIFYWLFDL
KCEFLYFFPRSNLQMINKYIQSNN
Download sequence
Identical sequences 5911.XP_001024050 3724.m00028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]