SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001024799 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001024799
Domain Number 1 Region: 463-620,646-708
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.23e-26
Family cAMP-binding domain 0.027
Further Details:      
 
Domain Number 2 Region: 360-460
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000235
Family Voltage-gated potassium channels 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001024799
Sequence length 1044
Comment (Tetrahymena thermophila)
Sequence
MSELLSEQKLRVKLEGNDHQSLVDLSKKIDTNIIFDETFDQCQDKCKQIADDTSFRVAID
PFNQSQDASSFAVFSIENTILINLIHYLNDFQVTMNGQKFNIYFKDIINKQFIFKIQLGL
QNEFESVKRSKTSKLNKKAITKETTHQLDQDVDNSQNIKNTAQSQSSKQNRRIVVSGKRL
SAKSKIQFTKTQQNTQNYSFVSVRGSTKYKFSGLNTIDKIIRIITVIKPQLLKYFENYTM
SGRYRFFNANCRLLLNDKVDFTEQNNEKKVKCIKKAEFEDLMHIFNYIAIGAWVSEMLIQ
MNTSTYYEGEFITDRKIIFKIYIKDYFFFEILPLIFEGKTSQNQALNIIYKLPLLLKLKG
MSIILLLTHLMACSYVALAQFETNILGIQTTWLNKSQIMVEEYKWWSAYIEAQFWAFHTM
GNSYSISVYTQQEYAFTSFWMLISCVLYAYLVNALGTILSNINSNSENYKKDLNILNRYM
QRKKIDLYIFQALFKEKFLISQFNNLQKRELQRIMNIHLQNQYEQQSQVQFELEKETLNK
LSHHMRNKLFTESNKNIIQQFHFLKQFSQQTLTSVYQIMQEESYTEGLIIPTFDDTTLDS
YVYLIVKGSVDIIQLFQYNEEESDFIQEYQTDEKKKSHDYQEKGQKVIKRLTAGQSFGEY
DFFVNTQLPYKVQSSKQTIVIKISQRQFIEIINNNKQDYQKFMEIRHKQRDQNHQRKQGK
HSRCLMINQNQNKQSIPYLDDDQESFHEYYKDDESSKQKQFKSQAPSINLNKKDSYGISA
LNVQEQLNSEQSQKELEPQKLNVNETSNVKNNSIGNNLTQLAPIIVNNNSNSNIQSSNIN
THNKRSSARTSIVIRRLSNNVNIEIKDQNDNQVIQYDDREKQYKQNSFNNIDQNYQGVYH
AFNKQLSSKVITPQTFSTHRQSATNNFPQNFDNKSLGNDHDNLHFQQELHYKTNELNAIN
NKNNNLQVFQKNSFQQQVSFQNGSQRFFFDNAFYKAQWDTTILYWMFDQKCEFLYFFPRS
NTWTLTIFQQGRYQIDEIILLDFI
Download sequence
Identical sequences 3706.m00043 5911.XP_001024799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]