SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001025223 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001025223
Domain Number 1 Region: 456-659
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.55e-39
Family cAMP-binding domain 0.0037
Further Details:      
 
Domain Number 2 Region: 394-479
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.66e-17
Family Voltage-gated potassium channels 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001025223
Sequence length 1084
Comment (Tetrahymena thermophila)
Sequence
MDLTIEAKNSDLSNNISRTSSFNRFKMENNLECSSSKHYNGANQRQNMFCLNEELRMISN
LKGKDENDIIQDPSILSNSRNVNEIDTSQMYVDGVKDKSQINVLYEQNKDYSFRNQLQNK
YTSLQIHTIKKNELIKQTQTVQDIASQEIIGENMQNTYDLQEKESRRLENTEQSPIQKQT
LINNSKFQHITLFTEKQKARESLKELPKSVRSSSRITPPGLNFFTRMKVSQFTRKFMNKI
KSLSSKYNLRQLTKKHYDIINDKSAFFVEKKAEENIGQRQKIIQLFVAFMLNIKEKLDSV
QPLNPESRFCVICDLIYGITLLAYLFIVPIQLSFNISFDLFELVVFIILVVNFFLTLNKS
YYFKGRMITSPRLEIEENLTSNSWLSAQHMTDAPWGSRYIICIYFAFITMMTVGYGDVVP
VTNYERIYVIFMTLLSSAIFGYVVNTIGQLYNQQAQKQEQFSKRKQEINLFMDDRKIDSN
TKIKVLNYLEYAFQYQKKKDQNPQILFQDLPQTLVEEICIKYYGRYLFQNKIMKLNFSEN
VLKALSNCMKEKNLAPNEYLFHKGNSEQLVYFLVSGKIDIVFEGKEAQIAACIDQISKEG
DEIGLRSAFIGSERSNSAKCQKNQNCTVVFFEMDDFKKILQNYPKDYERYCEIKDDIIFN
SNTLDTKCASCQKYDHITYSCPLISLNIQKGIFLHKYNSGGEPQIRKQHSTQRRGKQINC
LIQNELIRQKLKQYRMSLVFMIIPELRENEQNFQDRSDKFFFNKMPTVKIMDGGDMEAEI
EEYNIYDGYETMVHDDQCVEDEEESDNIQNKKQEEDHYLAIQNESGDNMIGSSSYSSSLQ
QLQPQQLQQVQIQITASSSKENIMNINQGQQQVQFQSQPITSQQKVSLFAKKTSQNIEVP
LNDASPQVNLSQINQASSRNLSFRRERGDSFYPPTKRNSKQLSQQRSLQSRVKSSRKNSE
IIQNSSKPSNQQVGFYHETYQDIVESNQAQTELFIYDFDRLKLFEKYFPYYNYNNVLLRL
NKKKPVFKPKKKIHKTIESYKVLFLNYKTKQSFENLINVKIREFFPYDDKKLKQRQIKLL
FVYL
Download sequence
Identical sequences 3732.m00080 5911.XP_001025223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]