SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001026373 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001026373
Domain Number 1 Region: 614-810
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.14e-40
Family cAMP-binding domain 0.02
Further Details:      
 
Domain Number 2 Region: 535-646
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.31e-17
Family Voltage-gated potassium channels 0.0026
Further Details:      
 
Weak hits

Sequence:  5911.XP_001026373
Domain Number - Region: 817-841
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0523
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001026373
Sequence length 1453
Comment (Tetrahymena thermophila)
Sequence
MNNHHKLTQLIYPKNRNTQNKNFSVQDDKSLKIEELSNNQVQQPIPQFIESNIQLQQSPD
NNFAKELLMHMENSENQIVLSYSPQNFSSSINKVDNNYKDNQVEEDKLFQNTNQLLAHPQ
TPKQQNIQNIQLQSRSKSLFFQQRNKIDSNILEKKNSLISESSKNSVGQKEDESANNNNL
QNIQADNSDNFCSEADIKTEQRRETIPESFNQLKQYDSIFSTQKSIKQDLMQRKYSNTKE
SKIYGFSSSAINNYGETPLNKANQSSFNIKSEKLIQESQKRYDHQKKSFQFTNFIKHEES
DGENSSIIQTNTNKQSNKVVPLNFSIVESQNLGSDVNQYENKISLTSNLIKPKKIGWNLA
VQLKNVNRFISKIRDQTSDLNYVKLKTHHLNYINDPSFQHEEGSGQYFQMKYDHIQKRFL
SAIPIFEPDNSLLITFKVCVIVALIIQIFIVPIQIGFQVNLYDENRTAEICLRIIPIILF
LIDFLCRMNTGFYQNGNFIEKRRDSISGQFKNFGYIRSFLAYGEVSISLQYNQIIFYLTA
SCPCMWLRISLYQYILSIYYSTITMITVGYGDITPQNQIERIYVICIVIISGTVFAYAVN
MIGAIFQEKEKKIADYKQMKFDISNYMINRSISKKTQLKVYNYLEYIFKKESESPEKGQK
ILNLISEDLKNSVYKEFYQMILTNSKLFSHKFSKEFIQKVSLRMEEKMYAPGELIYQQGA
SENPILYYILKGKVDLYAQKGDSKYFLGSLKTGDSMGHHNFYACLPLDYSCTTSEVTHLV
YITQENFIQCLKEFPLDQEVFTMNKDDIIFGQQRYMNPCFSCGKFIHSVIDCPLIHYQKN
KQFFISRHLHSVQEKERKSHQRQHLVKRNSLKIIKRVRNALKVTRTAMEYSYFQNTKIQG
SQITLNDLETDKQFYLRMTKFKFNQDNNLVMDSQISEGEEEEFDLEDYEIEQEEQNSQIS
QAKEIQELKEEDDYTQRSLNNITIKKFKNNQRLQRFGSCSSFKMGENDQEKAQQNMPLYK
RTLTNQNKLKQIKKQDSNQSCSVDGEKFDELNCSLLLKKISSNELNQQPEKIDVIQKKQS
SKKIESLPQTTQFQKEIFMQQQDFQNSQKNQDLNKYQNFKLNLQPIQLFGNHITGTINKQ
NLDDSLSPFQVILDDRNKIKITQEINSNLVDHLNNSQPKTSRQGSIDSLKQKKSSLNKEQ
QKPQNIINIQPNMINGLPNNLNSMNNLNYVQIGTPLLQSNQTLTGLPNITKNNKQLNNIC
YQLQQFQQKKENLNTQTLKPQILPQNFSNNNLKIGEIQNIKFNTVQQVQNVNNLQQNTMP
INQPYYQAYQENAQNQNAQNQDSLSPSQINNFNLNLLNPQLLNHQNFNQIAALNQHNNYF
VQQLIKRIEEFSIPNFEAMKEYTIYFVQYNYTQVLKKIQKKQIPIKKKKNHLNQSKLKGK
KKNGSKSFNILPH
Download sequence
Identical sequences 3731.m00047 5911.XP_001026373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]