SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001027353 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001027353
Domain Number 1 Region: 502-614,661-718
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.67e-28
Family cAMP-binding domain 0.013
Further Details:      
 
Domain Number 2 Region: 397-522
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000196
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001027353
Sequence length 1074
Comment (Tetrahymena thermophila)
Sequence
MSCDSFDPNRQMFPANESHTYKNINLKNETSFCFEDDETIKQVNIQTGSKSQKNQNYPIV
EIQSLEPYSFQQDEQKIDINQLSPEVTGMKISEVFQVNKQDKVIQKQQDQKCSLYISKKE
STNSPSLNYLSMIQVQKCDTRDIKVEVLDCSDQHKQQRRKGIQSMKNNKNNGAILSLFML
TRVKPKILNYIQQFTSFGRTRCLNKNISSIINDPIDYEFSNYKLLNHRIFSILMFDQIIK
LFQIMENLFFDLLSFIPLFNPENKLRICINLIIACYSSFYLYITSLHIFFNADFGSYEEL
FHQIAIAAWISEMLLSMNTFCYHHGQFITDRKQIFRIYIKEYFFFEFLPLIFEGRQSENI
FYNVLLHLPLLLKLQGISIIMNKIEFFVLQHIKYPQYIQFLKLVFQILLLTHFMACSYYA
FGQFEKYILEEKNAWFLNGVNGDKSEWWQLYFEAQYWAFLTMSSSFSMSVNTQYEQIFTS
FWMLISCILYAFLVNMIGDILREVNSELQREMNIHLKKNYEHFSKKSLEEEKEALNQLGN
EMKQKLIIESNKKFLCQFPFFQQKLSTQSLNLLYTHLEEETYIKGEYLTLRDQHNDDPFL
YLIVKGEITLMYDKFNSEEQNIKNEQDENKNVYIDKDDKEKINLKQFQKSSIFNLKERTQ
KQIKRLGVGKCIGEFEFFTNLKQNYIAKCSKKSIVVKIVRSQLIQILKQNDQDYEKFKLS
QDLLAFKNDLSQIQDLNCFFCQSDKHLYQDCHFVHFSKINPFIIPKSNKSVNQERQKFER
KKKSLKWTVKKRNEESKLEQTEDNMSTLRYISEFQEQINNESEDQNNSEKNIEQVPHVSK
NMIFSKASDCYSLTYNIQEDQQQNEIIIQNSSHITPTRLRSKSKMCSFKEETREEQQQHI
ESPSYSSQMKEYAEKQNNCSVFTSPLIEEQKQMKEGQEETHKRHQKKSKLKNIPEMNEST
FNNNYKKHQTLKQIHLDQQNQYASIDLISNKNQIVDQNNYNGKFNDKQIFATWNESLAYW
LFDKYKDYTIYFPSYNHKEIIKKNMIQKKNVFNKKKKIIVQKSKVSQMATLNQQ
Download sequence
Identical sequences 3734.m00057 5911.XP_001027353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]