SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001030201 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001030201
Domain Number 1 Region: 360-384,461-539
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.11e-20
Family Voltage-gated potassium channels 0.0039
Further Details:      
 
Domain Number 2 Region: 523-680
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.89e-17
Family cAMP-binding domain 0.015
Further Details:      
 
Weak hits

Sequence:  5911.XP_001030201
Domain Number - Region: 682-708
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00293
Family Retrovirus zinc finger-like domains 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001030201
Sequence length 1213
Comment (Tetrahymena thermophila)
Sequence
MIHRQISQTIIIPRFHQQRAQNRGKLFEGTDNDVSFHRSYRNQQISKQDVEDYQEQDVID
EQNNHENMLNLQNSTSRDLNKIHYQDQVSLRKDQSQFTNEYLGNNTVYSNTNRESNNLLY
AHNAISVENSPNQTFNFLQKQIAWLNERVIAKLEDSPKKIAKRKISSHISDFKSPQKKEI
SFFSKNQFESKEFIFFKPENQKDEMLSSQRLYKDLQSSGQNELDQENTFTVKNYLIIFTF
VKRFVMNLVKKTAQKNPMNLKKMHLALIDDKANENMIFFAKQRECQKQLQNQQLMSKQSK
YFDPIQSQSLQKNIISNAFQPDHALIIILNIILLLQLVSHILIIPIKLCFFIQAQQKSQF
LLFYSAAVLCLFIEIFIAFQTGFYESGVLVLDKIKIAKQYFKFQFWVEICSMVRKKIQRI
DEHFEISSKFPTLYELRTYSKQSGQFSPLDNWISVQKLDNSDWVVLYINSIYFTIITMIT
IGYGDIAPINIYEKIYVCFMTFITCGLFAYCVNCIGTLFAEINQKQQIFKQKRYELSNYL
KFKEYLHKESDVTIAKAISLKMKEKILGPGEILFTRGSPLQYLYFIQKGEIEYFMQNKEY
QRSLLKFNVTFSIFKKPQQINYFQEAKIVDFKLFATGQQADISIRCQTKTIVAYFSMEDF
LDTLKIYLVDQEKFCYLRDQMQSEELSDIKCMSCGQFRHNIFDCPKLHLGLSKDMIIKKH
SYSAQQERGEKIKFSKRQKYPTLRNQMLVRNFLRILRWQKAQESYTKYQNINVIQEVNII
ESDRQFFKRCPRILDSNKKIQQRQGDNYNIDDIFHLQIKSWIDEDDEYSSSESNLSENSQ
TFHSKSQSKISFQNQILPENITESPQHIDAILGDIIYTSNNQKKLVSKIQNPQIINMIKE
EEIDDSYQSSQIIPLSEENIKLDINQEQLNKQKINNTTISNHQRAQIIYKNNIQNFESTQ
DQIQQNLSIRLSKPLQTNHGQTGDSNNRDLEEFNDIDQRSSPLNLQGVLSTRNSFSQQVN
LVNQAAKNINLVNILNQQQQANDSLIQMQCPQKNIFEDTSSIMNQGSNDSKNRDCYRQES
DQNNFRKQIKALQKSVNMLQFTILQQFQNLSKQANTNIQNDYIKKKTNSALDQAKSFIKQ
KQLSKTQFDIDGNKSFNLESMTQQNYPNLTLPSKEHIFGKLQFEFDKNIWKSPSTKVKFN
NTPIQQQNQATEK
Download sequence
Identical sequences 3802.m00182 5911.XP_001030201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]