SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001030585 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001030585
Domain Number 1 Region: 511-710
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.27e-39
Family cAMP-binding domain 0.0019
Further Details:      
 
Domain Number 2 Region: 389-550
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.59e-22
Family Voltage-gated potassium channels 0.0042
Further Details:      
 
Weak hits

Sequence:  5911.XP_001030585
Domain Number - Region: 723-751
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00251
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001030585
Sequence length 1751
Comment (Tetrahymena thermophila)
Sequence
MDYLETEKDRLETYQSQNDQANLRKQDQLNRKYKLRIKCDSQENSFNEMNIVQSPNQAQS
HNNMSEQNKSNCIKKIQDSVIFQDKKESENANNSMKIQGNNENKLDVYQSSYFDPQKEVY
ISTNQRKYNHPNQNGASHQVPFKRKLTRKSEIFQSQVLNPQDISTKDSEQVIKSQKNFPK
KKQGPNQFSLYFKTLKAVRQFKLFLIPKSINIRSSKIINDASHYVETNKAQTAFNPFEIM
EKISKSNYNLKNFFRELKSVFSDTKVKICKFLDENITVLDPNGYFKMIFDIMMIFAIIVC
IFFNTVEIFFAIDFYDLYEYGYPILDYFLLILFILDIILNLNTGVFNEGQISKDRVEIFN
SYYDGRLLHDTLSLLCFIRQRNHQIVTSFFDLFVFFKIGQVSLKLQQYQQTAAHCVAVIF
YGQVIFAEWISFDDAHNWVEASTVVTRSDSWLKIYIFSLYFSVTTMTTVGFGDITPKNGH
EAVIVIISMIIACGVFAYTFNLIGSIVSEMNRRQEEFKIRMKKVYTYLSNRNVDQDLKYQ
VLKFLEFKYNNENTLSQEEEEGILDGLSDNLIYQINYQSKFKILNNGFELFKSFSKEIKD
ELCMKLKIIRGNKEEIIFEQDTIQDDPQMYFIHQGSIEIFFKNKQTKNNKESILNVLKEG
QFFGELSFFTDKPRSAGARVKSSCILFSLSKSDFLSVLQNDIFELEKYHLLNSKLQFSES
NQQISQQCYYCSKETHIIKRCPHLHYNPDNHLIILKNNFSVTSVERKNWVRNREKSRAFE
IMLEVTDLVSYMKKKNKSECQLYSDQGSSDEYITFEDQDSSSQDQLMYSNHHREIIQKLR
KMYNNQEITVSDQNSNSNSQSESEQKPSKRDSQDKLSKTNSNKIIDNNDGKISNVEQKSE
NQIKDELLSPPIYLNKHFLNVEKQHSKQQRHSLQLSQNQNSQHNRLKKYQTSNLTQIYHN
IYPKINIQDDEDNLQVESDSSSQQNDSKQDKKNQKQIENQSQSSNQISLRNGQQSYSPSL
RIEKAEQNQNKPYRESFFQNFKENENKSIFNCKDSANLIQLQPNQFGQQQFNAGFQSNLE
IQQQLQNSDIGSQQTNNLEKQLLSNQGINSLEQQQIQNANQLNIQEQNQTNNVQIINLQH
QQINNLEKSQQSNLLQEQQLNKEDNQQQNVSHQQLRSDNEQFNLLQQHQNNENIYNNLQQ
NPFEDQNILYQQEQKQQNNSVNGKIQIQKQTQKENEVFQDSEIEELIEENDVNIELKQPD
SMEEFQSKNIGNLQERSKTAWIAENQIKNNSQMPKKDLKSFQRRSIQNHIESHRKSKMLS
LQQSLEVYVQQSLLGGAHKRNMSSQNQSLHQRELSQNKSSLIQLTNNKKRTLRFSNVETF
ISVPDEVPFSTPIDNVKNPFNQKQAQIHYIGQPSPSTVCYMPSSFSSSQPLKQKIEANLQ
INDQIIENEQQQEQSKYQALNKLKSKETNKIQHEPPQIEEEPVQQELHKEVKKLARKDKR
TKTHNEQNGMMHKFQAREQQNEHSDDNRKKAESSKRDKFKKRTALIPLQNGRLNPLRTLG
LFREQKNKAHNIIPQSPYSIATSQSPNRLNPSKPELNSIKDKSLQERENLQGSQMRLSTF
KFNQTTDQNSIQNYQQQKEGEDQINRDSIKKQIQMQRQQTVQLQPDLMDEVKIVQNDTLI
FDKMKEYKNYFPSFNFKTILTTYNKLKNIQNNKLPSYFNVYSFYNRFDYKKIYKQKPVNN
SVLKRSVANAQ
Download sequence
Identical sequences 217.m00053 5911.XP_001030585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]