SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001030962 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001030962
Domain Number 1 Region: 371-566
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.18e-41
Family cAMP-binding domain 0.0084
Further Details:      
 
Domain Number 2 Region: 275-389
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.85e-19
Family Voltage-gated potassium channels 0.0016
Further Details:      
 
Weak hits

Sequence:  5911.XP_001030962
Domain Number - Region: 575-597
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00138
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001030962
Sequence length 973
Comment (Tetrahymena thermophila)
Sequence
MLKKQIQNNQGSLRSGAENMRSNFMKCNYDQEDILQMPYKQEDTIYQLTKTNKNSTQRQR
SVQEERYDNYIENDVESFVAYQDELGKTQESKVFSKYHRQDGNDNSHIYNDDASISPNIS
CVQSFKQSKKQKQSDQQDDKSVLSQTYNSNCNSNEMNEAIKIKFPSQKEHNKSDFIFSPN
LPQADSPITLQQSNSINAASFRKCDDTELERDSAGFIGAWKKKPLIIITQVKQFIIQIKK
YSQALKFQQMKINQFKLLKDNASDFQYYQMNEYILTHYCGCFFFLIAVIENIYDIQQTWV
DFYNLRTATIQEQYITSIYWAVITMITLGYGDYVPKTSYERVFVIFITLISCGVFAYSIN
QIGTIVTNITKKKSQFQQKMAQISGYLNERGIKNNMIMKIKENFAYLQRETEKDMEVHNI
IQTQLCKSLRKEVFREMYIQILKGCKAFNLNYSEQFLLNLAPLLKEKKFSPEEIIYEQDN
PNLNLYFIVKGEVQLFLDMGGKKRQIKILSKNDVFGEQPFFSQATSNHSASSVNVVKVVY
VNLQDFLSVIKSYQKDFETYCMMKDKLNLYSTSKRLGLKCYSCGQFQHLIKDCPFVNYIP
NKDKILINYKAETIQERNSQNQEFRKKIMKHDKATQIQKQIQEEIVNFLIEKNLYENLNE
LLQILKNQEIVFDQKNEDKEQKTQSSHKSLQVLYPKMNNEFGTENIIQENNSPNKPHISP
TIQGSQYVIQQQQQRKIKRTQTSQIGRSDSLAFLGASSSKLLSDYIRYPTLEKGESRKSN
KHTSFLNSQMLRESSRKIILEEIKESQKLIQLSVQSNQNSQNTNSNISNSILNNQSLQSP
YNSNIQYNQQSQQLTFTQQSQNNSIYAYGPNSNSISVNNSQSYNQIQFQPQLDQINKNVQ
NDSKQKNDSQSIKNYKKISSITSLSQKNKKKRRSNAKSSQLTKLDIKSFQRLKPTVQLSD
LINLMVQLRAKQF
Download sequence
Identical sequences 186.m00077 5911.XP_001030962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]