SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001031701 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001031701
Domain Number 1 Region: 574-772
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.3e-37
Family cAMP-binding domain 0.0024
Further Details:      
 
Domain Number 2 Region: 353-566
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.02e-20
Family Voltage-gated potassium channels 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001031701
Sequence length 841
Comment (Tetrahymena thermophila)
Sequence
MRRPIFQDNQTSLDQKKVNESYSLAQQSSQRTTFRELNSSEIRHQPFVYASDFVKPALGD
TNARDRDLVADDLSQEDVKSNNLESYQGSFFYEIKMSKDKNFQSHQNSIFHSRYNVNSNT
QSQSILDQIQLNQQHQSPQSQVTNSQVIKETEEVRNTQSIRMNDNASRQTPNRKKTSFPK
VSSKKLTKYGENARKSNLFTELQLLKLQSEDKSVVNITRKSNQIMDIGLGGKFIQKAYLV
YNFISKLKKNCGFYRPDTLNDNQRKLIGDLSNINTPAQNLWPNKQTDTEESLDIKRQSQN
IKNQSMRSGNLLNIRKHGSTAFIANHINSIYSLAQRSSFFQKVCEIPTFSPHSKILDVFE
IIQVVMSLLCIVYLPIEVAVKQTFYDLYGYKWEWFILSSIVFFVLGLLLNFNRGFYDKGL
IVMNRRAIAKLYLKTGFLYDFLSMVPLVLSYLGVTGYLQFINIFVFLRLKNIMHFFQKCL
YIHIDSKVNWVTRYNSSPVQLEGDWFIKYIYAFYWAITTMTTVGLGDLAPANTIEVICYT
IFMMSATCMFAYYFNAIGIVVQERNKISKQLSIEMTKTLRFLQSKQIEPEIQYEVRRYLQ
YKYSAQKNMISLEEEREILEKLNPEIQQKVLFSANIKIIECCQFLKDNFSYQFISKLAVK
VKSQHYLNDQYIYHEGLSYYDESTEKKLYFIENGKVQLLNENQITGKVHLANTLQRGDVF
GQFEFFSNQDYSMSAKTMEPVKLLVIEFNEFYQLIKDFPTDYEQFCMIRDKFQFQSRQNL
QIKCESCGSLYHDILQCQKIHFVPNKELVILKNNFSQPIVQRKKRPDEERNIQGVLRRKW
N
Download sequence
Identical sequences 5911.XP_001031701 3672.m00067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]