SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001031860 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001031860
Domain Number 1 Region: 418-619
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.36e-48
Family cAMP-binding domain 0.0059
Further Details:      
 
Domain Number 2 Region: 311-452
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000000157
Family Voltage-gated potassium channels 0.0044
Further Details:      
 
Weak hits

Sequence:  5911.XP_001031860
Domain Number - Region: 626-648
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0654
Family Retrovirus zinc finger-like domains 0.0089
Further Details:      
 
Domain Number - Region: 763-833
Classification Level Classification E-value
Superfamily PF0523-like 0.0955
Family PF0523-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001031860
Sequence length 1713
Comment (Tetrahymena thermophila)
Sequence
MRAGTSEYHNIQFTAGSNLQQSLESQKDLNKLETNQNELAKSQKSKNAKSSIQRQIGLGL
KDSENSVISESFNRYNHKINVTPNANNYKHSNTQNMNQSLFKRNNTQKPSINQFSFWSVV
QIRKMMERIKKKYSYANLTSLQYELIGDKSVYHHKKETFKEKYGYNQNQEEELPRLFNRV
SECCRKTLRCHHLKKRIQSYFQNSVDFIPVFNPSNPLKLFWDFLISLSLLLFFFAAPIHI
AVSSPITQIVEQTLLYVCLVLIVVDTIVSINTGYFSKVPFFFTIPQSSYSFFPSILTLLI
FIKFGDFSKIFKKLEEQFLLRPTTTNIVELLKLLFVLLFVAHLGACVWMFEGLQSNQQYK
WFLTDKLDDMWSPQWLDLYVKAYYFNTVTMVTVGYGDIYPVNNYERNIFQDFFRHAQIVK
ENFYTINNYMEKKNISSQLRNNIKEYLSYYWDEERGNLTEKEQKIICQLPESLKKELKVE
ANKIVLKDNPIFHQNFSKFINDKICGIIQEQRCHPEQIIMKEDEQDDCSIYFIQKGRVEV
FIKQLHPDGTLATKSIMILEKGQYFGTYGFFTGLTRKQSIRCMEFSQFLVIKRSDFIETL
KQFSDDYERFCMLKDQLMFNSKNSGIDQSCFGCSSKDHFFLECPAIHYAPNQQEIIKKYN
FTSTHHVRRQKKRNFTKYHTLKEMDQTFRDGIKFIEQNESFLLEQDWLQSVSEDEISDDS
NSDSYSDSREALDHVDKNHVLTIFSQLPNTNSSNQLQQTAVFYNHEKQQNQANQNDSKIV
SNLNSVNNIDASLKTHLIEEPSSNKAQQVISQANKERDDFNLSEANPSPISKLKKVNSEI
DTELSVCQKIQSTQKIKLNPHNSIFQQEQEFKHHQKEDQLQLIERKKEQDIANNQLKLCQ
SQNFIDVSLGPNQANSFNFTFKQDSEKLIRRQSYWNMKVNIPASNREIQIPLASEQQLQD
NKDNQKPRKQSNTIKEKIGSSNNHIISDIISNETKSLNGENYRGIQTFNQIESHQHTNAS
LDLQSNFTKSKILMGDMLNMSESDKSLPQIQKDETNQNEMNLLCVFDIQRFDDIEGIYAK
NQSPKFVSNSNRRSQAMKLEDDFIQNNGGETERGLLENTSLNESQDIKQAQQKVNGLTIQ
HNKLQNKQFDEKAILRQNLVEPIKDNKVENKSKIIQNLDQNQKQFSQNEQEKKIFNMRIP
IEKINLQKESQQTIQEDLPDIGNYKRLPVQRKQVTHQTSIELNHAKPIVNQLINANQRQS
VQHFQSNFMVNSIQTQNTNSKPSFTNSNIATNQQLGDQHPLTKLGKSNRNLMIGSLYNKD
KQQIGNPDQIDQKAIKREKFWKNVQKHGYDMGATDVSSPLILKAKKKLVEINSEGGQIFG
ANNKLMNKIASNASQFSNPTHVEDNQRFTHKGIKSLKKDYSPTSSIMSQKKVGTDNHIQS
HESAQIEQLKQMISNLLMKFEETKGQSHSQINAMSRKSVVFDKHSPLLLMHDYIEENKHN
QIQNSPLISKYQLHNPASPQIPQQYPLNIRNSDDLINSNNMYNQELIQEIIFDTMKNYSK
YFPENNIQFIQNELNKVSQEKLKQMKKQKIKKAKANYQLFNSLEHLSRDQQFKRRILNSK
FAKQSLMHNTRQEQSEEELNSERSRSNSGSNSKRRSLFFGIANENFSHAVNSFKNQKRQS
LSQQSISTNQIPQINQGSHIIPPPAQKFSQFKN
Download sequence
Identical sequences 115.m00092 5911.XP_001031860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]