SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001031904 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001031904
Domain Number 1 Region: 619-825
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.49e-41
Family cAMP-binding domain 0.013
Further Details:      
 
Domain Number 2 Region: 511-657
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.14e-19
Family Voltage-gated potassium channels 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001031904
Sequence length 1283
Comment (Tetrahymena thermophila)
Sequence
MSKSAQNLQYQDYSMQDNSKFLDQSQISLHKSNYIQQNHDQTFQLANPYSNRKIESSLNY
PDLMRDGEQKRQNIFLQQDSSLYDRNVKVFSQTVFDLASDIEGNNLNKDQFEQGLHRIFD
SKQGNQKNNNDSDLLNRRSQNKLTIDAKSSNEINNSYNSKNNGSNQLLDYQNENISPMLK
IHKTKKHATQVPTNFSQKEINLQIQNQQPDNNSSGYGGNLMSQLVSKMSQKHSSYAISYS
SNQNESQVITNRMNESSQGSNNGQNINYSQKLELNTINIQTDKGRNLLTASKNDSLTNNL
IAQDIPSSVANNLNNNQKVINQPLLNDKEANDTNDQAFEELQKKKRSRMSVVQQSTVNKF
SFKFFKKANMIKKFIQTMVSQLPSKVFQKLEYRHFNIIGDAVFQFNNMVSDDEIIFKKQL
QKSKTQHKLSTVGSNIERAISNRNQYSFTEQFPIIQPNGIFLVFWNIFFLFFLLIQLVII
PLLCVYDQAKDTQPFMFITEPLAVTVFIIQMLLNMNTGFYNEAHYSSCIFYLISKLDYQN
NPDISTWIKNIGVTNEYWTVIYLDSIYFSFVTMVTVGFGDIVPKSSHEKIYVTFFSVVSC
GIFGYAVNTIGSIFHELSQKQANYKLKKFEITQYMEGRQIQRASQIKVLKYLEYMNSQEE
ERNYLCKGELILSGISKNLREEIYQDFFGKILFNSNIFKNNFSNKLIQQLSLVMKEITLG
PGDIIFNKGDTDNRLYYVFKGAVENTLEINNQIIKFGQYMQFYQTQQGEFFGQSGFFADI
PRYFTAKSKGTTHIVYCKREDMLKLIQENPSDKEQFAMCKDEILFKQNICGHKCLSCLKP
GHIEEKCNYINIKINKPLLIVKNNFSLDQHRCTAERQIKKKYNAIKKYIVTKKLLKQLRV
TCVLEAVEQWDDLAILQDNKITDKEFFMRMPKVSYSEANQCMQETGDSLYSGDEEDIQFF
SKEDYKGSQDLVQGLSEMNPTSNINITNNKNQNRVNLRHQTHKLSIKNEEFSIDKQSISR
SKTKKETYAYSSPTQVNKRFQQLDLNLSSSQQGLFFPSNQQENNVSLQRQNSQKTARTMQ
RHDSSSSINSYQDTFKRNASRNLSHFGTQAQTAQYINLQIASNMMAAKQYSDTKIESPRN
RSNLSAFNPKPQDNKQDQKLSSLNAENADQQKQIQQNQQFEDFFIETIENDFDFMKEYTV
YYPQNNISQVLRQIRKIWLEKFSKKRAKTKHSQKTTQKSKKDLNKSIKKSETKITQKTNQ
QLQKIETKNTQKTFTNYNQSFMN
Download sequence
Identical sequences 115.m00136 5911.XP_001031904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]