SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001032561 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001032561
Domain Number 1 Region: 549-746
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.44e-36
Family cAMP-binding domain 0.0029
Further Details:      
 
Domain Number 2 Region: 405-533
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.24e-23
Family Voltage-gated potassium channels 0.0026
Further Details:      
 
Weak hits

Sequence:  5911.XP_001032561
Domain Number - Region: 748-777
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0153
Family Retrovirus zinc finger-like domains 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001032561
Sequence length 1267
Comment (Tetrahymena thermophila)
Sequence
MKNQLKKCKLRDIFQTRGPQFNFNNQVEASKTGDNDDYLSKFPESFKKIDDSAKRASKEL
KKRLSSSKKEDHNKVSMQASIEEFKQYNQNFQSNSQIPSNQEQSFTNGFGTNKILALDCT
QSLLPIPKQQSRVRQRSELSNSIASSGSLADDDANVDNSSQANPSSHFKKKINNAINKHK
ELKNVPQRLSTQKFTFLNNQKKKSSQNIQDKANINTSTYDQEIVSMKKNKRRNNVVMLDK
RKQIWTKNWVQIIYYIGKMRQLMNQAILFFRPQLLTKWQLNAINDPSCDFSNVYHQHQNA
DYVKQYSYQKYQRFLSFRTYKKITFGFERGPFFSIYFEYVCVFVFCIDIFIRSNTQYNEQ
GNKIEVHKQILQNYIKKRLVIDIISLISLNRTYFKSNFCSLLFFLRIFYSTRIVDIFKEQ
FLLRVHISGIISLILLFSQALYFCHIFSCSFLYLGLYQKSFGEGWLVTFQLDQSSNLEQY
LHSYYFSVVTMTTIGYGDYTAKTSIEYCFMIVFMIVSCGIFGYTINSIGKLLLNNIILIS
NILYDFKLKRDQFLQQLAQINKYFKFYNTDLTLQSRARKYIEYTYSDNIQDTNISASSLD
SLSPYLQLEIKYDAYKKAIVKCQIIKQYFSTPFIESLATKIKETILSPDQLILEEGQNKE
PHIYFVNSGMVKIFSAKNDDSPTELKKLVNGDVFGIEEFFLEKYDVPFSVKSIGVTSLLS
FTLTDFQDMLKKYPDQVEMYCYLKDSLQHNKDFSKLQLSCFSCAQYNHCVNECPYLFYGT
KPQKIIRQYLNDIDKIISTFQRQSRPRFNSRFLNEEVRERADCFFMDYQDDLSFIGYTDS
EEEDDDEEDDEDEVDVKTQNENHQGVSVQSTSQANLQSQQLKQQSNPNLEDKKQKDDRNQ
KEDRPSGLPLQKTNSLSSSVKMDQESFLPPQKQAENYVYSNCNIPKSISNLPEIKESQLK
IAQMDIQNVKSIIAPQESNILSIPSNLNPGQIERKKQRSFTSINNISSSQGDLELRPQQV
YQNVNITSKYGSISRQQLQQGYINASSRKFSQENDSCNSITVVKQQSKRNIGRQVSRENK
DIELRDRKSTKNLDSQSGGGGFSKNYNQDLDMNFKNLNNPQNKVSSQFDSIQQVQSVFQP
QQQINIDLKDLFQLLQSYNMNNQIPNSTQSKNLKDIESKKLDLDVQPSSKQRQIPDKEES
RLYRMKTTKKEQEQLYDIELDKIQNYEIYFPKYNIENVLKKLKQQEISINIKNYLFKTCQ
NFFPLAK
Download sequence
Identical sequences 3675.m00006 5911.XP_001032561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]