SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001033032 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001033032
Domain Number 1 Region: 444-637
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.83e-44
Family cAMP-binding domain 0.003
Further Details:      
 
Domain Number 2 Region: 328-483
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000184
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Weak hits

Sequence:  5911.XP_001033032
Domain Number - Region: 655-676
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00164
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001033032
Sequence length 1142
Comment (Tetrahymena thermophila)
Sequence
MISDIQSTHRMRENQEWIHPANIQLNDLGPNVSDRYSDISSPNRNSFIHDQCQILVLYKK
DSAEGQKKALTRYNQEEQHQTQREHLKMEIQEQNEQQISSSYRGLSNKQSKAKSKSTSQN
FSTQKRQSKLNIFSNLYTEKSQMIYKTKKIIKKFLKEDKPIQLSDKAKSVLSVFKRIYNF
IQVVRVFTRSHSITAEQVQVVQIDQFSKIKCLYCQLTKLIIYIVFDFRSRLLEIDEGVSK
ASSIYTTNVYILIFTTILDVIKGFNTAFYRKGETIIDRKEIAINYIYGRFFFDFLSLFSV
VFSRTFFPDMDKLLMYRIQFLFLFKIHNIQHVIYVFQKTFIMNEKYDNIISLLRLMGILC
ISSHVGAIMYHTWLDQAGILNENYWVRYINSFFCSAGTLVNAIVYNPKTTIETVYMTFTL
LGNCCIFGYVINELGNIMDNIVKNQKNSQKELRLINSYMETKNVNRELQTRIRNYLEYMH
REERQLNLEETKQVIEKLSSQLKIELVKEVNIQYVAVFHILNKIFSQKIQEKSLFIMNDI
KFTPGEVIFLEGDYDDCSIYLILEGQVNIYHTNNKDEDYIVQNLKKGQCFGEIAFFTGQQ
RNASARSNEFTTLIKIEREQFIQLIKEHSQDDYETFQQINHKIQQSQDYSQIYEKNTKQG
KCYTCGNINHISKNCTLTHFQPLPVAVIQTGNRSFQQDRQFKSRSKKNKWHPRKNLNLIK
MEEAAQVKSSFYFQRQIHINWKFNIYFFINDCYIKYFNNQIKRAGEEYITIIEEINYNIL
DQSDYDIDQSIEYQNNQDRFMNYEKQNTRDNNQFMLLSNQDNVEGILARGDQKNLSFNFT
SNLFQDSKKENQQYPPYDYTKQEGKDFRENHKKIDSNNSIQNKDIQYLKDQLQRRGSKFA
PLQTHTLTQIQESPTYLQQGSQPNSQQGNIYSSNQQQQQQHLNAMFNGLMAQNNSFQSPN
YNIQITSPKNNNNQVQRISKKQGTHNYSGTYIARKLMGKSQIPPFDSFPRQNTNQTNIAN
GAYQNNFEENKMQLVNNKMKDSFINLVEIFKSNVSLQIDFMRNYKKYFPDWNISEIERKN
KCKLASKNLYDSNKNSITKRNLISNKIFSKKSNKASDYFSQLNTRKNQKNDNLNPKNKNE
EE
Download sequence
Identical sequences 3686.m00103 5911.XP_001033032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]