SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5911.XP_001033235 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_001033235
Domain Number 1 Region: 371-507,569-637
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.75e-36
Family cAMP-binding domain 0.013
Further Details:      
 
Domain Number 2 Region: 281-409
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.4e-23
Family Voltage-gated potassium channels 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_001033235
Sequence length 1691
Comment (Tetrahymena thermophila)
Sequence
MLEAIKLLKGQSSFSVKSQVVGQLDSPKNQTNKVVANNKFSARNIFVNARLKIRVAKLLS
ALATRRFNNFTPYLFQKINDKAFYNTHTNKVQELIKIQVEDEYQSNLLHKQLLANRRNSK
LSKDKHFCSYLIQRIQFILENIPIINPNSLPKLLWDSLLSFVIVVMLTVVPVKLAVQDYF
LSYYLGTELVLILIIILTIIDIIINLNTAFFRNGKIVVKRIILLKQCCDKSIIGPEKELV
LSSLINSPFTLILCEIIKVKQILLQSRRDAELQKKNDELSFIRHIFACLWLFVGREDKDN
SWLKNLSDDWKEQYIKSFYFIAVTMTTIGYGDIVPTNLTETIISIFSMIIAAGVFGYTIN
SIGTIFLQLKKEDEQIQENLFTINRYMSEKNITRELQQSIREYLEYYWSQWKDDNSQEEQ
KIIQQLSEEMKMSLLMQANKIILNDCQFLQKNFTQEALQNCVKLIKEKKLTPNEFLINSM
EDNSKNGILFFVERGEIDIYQEFSLTQISTLNQSDQPFTNPLQNISNYLNISQNLQGQMS
QQQQQVKMQNEQSNLIINETSHSESNKAKMHVCTIKKGQYFGENSFFTNFNNRFIAKSRG
FSKVLYIERDQFIEYLKANHFNDDYEKFCHLRDSIIQNDLQNLHQKCSICKNLEHNPLQC
SYVHHQPLKLIVLKRYNCSKDIKIREKYNRRKVKQKNCLSHLDEIYEQFEKFIQKNENYI
EENIKLVDYTISDLSDDFDESEQSSSNQESQSTIQQEQNNLSNQLSQFQQLQNENNKVEE
DLHSFQEVEADDNTSLFKHTTQTKKLKQQENKFRCNQALPNKFKQSQRANYLRSRTDLRA
LTMKVVENQSDSSHSSEKESQKQVEQKSHENIISQKKIELKISSNGISKIVNQNSGKNII
PSISSFKRIMFQDEQPKSYVKQLSQKNIDKQPQQSANTQHQRQSLNPFNRMKSIKAGIIQ
RTAQRQSNFLESLHFQNQIQYETNNENKKSSNLLEKKQKEENISLKKQRRVQIFTTQDYA
AQDYTNFHLFQSDFAFVSSFEVMKNYKFYYPKFNSDKIISKLRRKRIQGNNILKLTLQAK
SKINQVRRESIFQIFQTQLNVIKNKRLSDKFRTQEPSSIQLNEKNNQQIQQYEQSAKVQQ
IQEEPKDTFTDHITEKKLIDKAEPLKVEQKSNNSSSKNFFKNIKLNLSKKPLSPQQTMLI
NIKKNSISDENNLNLDDEDFNFDKSLTGSGYNRLKLSRTPSNFTKLNFIKNDSQQIDDNQ
TDIYQSNFMFVYLLFVSKDQKQCAINAALPSYIKIIQQQLMINNEIKYYALNIFQLLDLK
QRQSDKLQSFIDTIQDYKKEMIESIDKQINIQTQLVQEMYRLESITSNYYNEQLQLSVKL
VEIQIQKLLSQTQISPKFQITNLIQLAQNDFQQFSSRLNKKDELEEIHACITKNFKHKDF
ETKQNEDLLDRLKLITNFDQYEYLQNDIQENKSAISMRYSPQYKQLQSQLSSFSDSLIPY
IKYANDTALFDQLLPSKMFYENNFRVIMNKYFSSGESLVNLQFRQTDERFFKKPPFLQEF
QFKNLLSLSVNVDSLDFKNLIIFVQNHPQLQSLDILLNVDQQLIATSNLRSLFSSQILPN
IQKLKIDIARLNFSNSVQINDIYGFFQPIQLFLNQKRNSIQNFEIDGLIEFNNTKPNHVT
LKETNILSSRY
Download sequence
Identical sequences 3679.m00010 5911.XP_001033235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]