SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 5911.XP_976868 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5911.XP_976868
Domain Number 1 Region: 577-765
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.55e-33
Family cAMP-binding domain 0.011
Further Details:      
 
Domain Number 2 Region: 442-577
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.96e-22
Family Voltage-gated potassium channels 0.0055
Further Details:      
 
Weak hits

Sequence:  5911.XP_976868
Domain Number - Region: 770-796
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000293
Family Retrovirus zinc finger-like domains 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5911.XP_976868
Sequence length 1544
Comment (Tetrahymena thermophila)
Sequence
MSNEEWKPNDQKNGYGKLSSFSVSQKSKFQLMSNNTKQRVYPLDNNLIVEENSILEKDTP
IIHFNNESQNKQDIFSPQNSYNRFIFQSSIKDVYNRHYSVDVSKFQSPLSQSESNQQKSG
QNIEDNLEEQFTKRSQFNTNQNLQISQGENQLQTNEKESDKKTTEITEMQNKKNPTLFAL
NYNKDEPRKRYSEFIPSSQKLGFSQSSKILRRNGVAPNQNNKQLLGRITFLNVQSAQNQA
SSENESVNQENQQVQNSNGISSYFNINKKLSLSWRFINILVLIQNLINKLKISSQTYRLS
KLNSTHYFYINDITHIVTEKRNIYKNQLTNFKEFLTDLKIIKLAGKLSVLQPEKMFVIAF
FNFHPELKYISQILLNYLPLAACICDILINFNLAFFSAEGVVIQDRVGIITNYLRFSFWL
DLVTTISLGLPYFQYLDLCFFLRLFQFLEIVNYLDERFQFSQRFNTAFTLIKLIATIIIL
AHIFGCGFYYMSFYDPNYNWVVSCNLINKPWETLYLKSVYFIIITMITVGFGDITPKNNA
ETIYVLGIALLSCFQFGYTVNIIGSLFQEKAQKEAIIKILKKDTSLQTLVLKNLDYIQTQ
QIDAPEQGLYILDQVSENLKNQVKFEFYWKILKNQPFLNHYFSQNFLKSLTSVMTEKTYI
PGEFVYQINEQSQSNSLYILLKGQVDLTLHSLYQKNSKKKFTIQSKKSGELFGHHSFFTS
SQRETDCECHVTSHIVSCTQDNFLAIAKEYPNDYEKYCFIKDQILLYQNDKNIKCVACHK
FGHSIIDCPFIHNMNHKELVIQKFNYSEDQKRNLDFTRKLKKNNTFSSILQTRKDLKKLR
IKLVKSIEQQREKKQRKTQQTTTTGGVKEIFSSKFITQSPNQNNQNQSNSENSSVDSSDL
SDYKYEMQLEEEKNLLKKQHQNFPYMSSYYDKQFYQRYSKISLNDKLCFISSSNSSEDLS
EESKSESEQSEGTIFMNSINYNQTINEFDVGFSETKIDEFSNQKIGSQKKLKKMKTMKGV
SKLNQKIAQIIKYNQDNIQMSIDQKNLRHRTKLHRPDSAPQRKSIIENQETITNKLQNFT
HNKKRPSSVKLRTDTNIIYSDDSQEELNSNEKNQKSQNFTSNQIRSNKNSKTVIGSKNSK
TNYQVSINCINDKNFSQQTLEAYENDKPKQQKGQKSDKRFSNEHKLSKSQIVSEESLDSS
QSSKINAKIDKQTSSQISSKSFIQDNNSKDNEAIIQQQLKITQHDNLEQKLSSNMPLKDK
INDEIANAFQKTSNASFDNQFDTLNTQEGIGSPKNLLQIYKNQQQIKPGSNKFITSIKIN
SSKQKIDIIKKHLLDDIHEDLAINREEKISNAQKIQPNVLKNDTKQSSQSLNQIGIVKFD
SNMLSIKQDDRQNLVSNENQKQYNKLNLNPLKKEQNDSDDNQKFNKTRSKTIHLSKKKIQ
NNPKRHSNNGLVLQNQLQVKDTSKVNNPMLKSTNMNNSTIKLKEEENTNSTQEQNQNQKD
KNIKNQSSIVPVIGQQNSAVNFVNILKKRLLNKQRHSIIPPKQN
Download sequence
Identical sequences 3825.m02595 5911.XP_976868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]