SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59374.Fisuc_2288 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59374.Fisuc_2288
Domain Number 1 Region: 20-108
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000275
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 59374.Fisuc_2288
Sequence length 195
Comment (Fibrobacter succinogenes S85)
Sequence
MLDTKNVGLFLLLPAPLNPIGAFDAETFKANFRAVMTANDDAKFIAVDLSGIDFVYSDAY
NAFMQFHQELAKRNGTFAVLADRESLVRSLRKVGLERFIRIFMSADEMAAYAPIEQKAAV
LEQVEKPVAEEPAKPEVPKTQAEPQPAPETPVAAHTEPRILDKNPLVDESSSKGSLVTVI
ILLLIVIAVVSYLVL
Download sequence
Identical sequences C9RKS6
59374.Fisuc_2288 gi|261416673|ref|YP_003250356.1| gi|261416673|ref|YP_003250356.1| WP_014546926.1.27150 WP_014546926.1.74657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]