SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 59689.Al_scaffold_0001_499 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59689.Al_scaffold_0001_499
Domain Number 1 Region: 95-158
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000922
Family B3 DNA binding domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 59689.Al_scaffold_0001_499
Sequence length 173
Comment (Arabidopsis lyrata)
Sequence
MGSIHVEPLTACGDETECYGGNREGRQSFHSISTKEENLEDSYLYSFLYYCTRSLFFWNE
RADAAVAGEVDEGKIKDFDFLSPAEKRIIEEHANNEREEGVDVILVASDLREFKLNLRRW
VMGTSPLYILVSGWNKVVKECRLEEGNKIRLWSFHVNDQLYIAMVPLSPTESG
Download sequence
Identical sequences D7KF64
XP_002892304.1.15461 59689.Al_scaffold_0001_499 jgi|Araly1|878732|Al_scaffold_0001_499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]