SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 59689.Al_scaffold_0008_2296 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59689.Al_scaffold_0008_2296
Domain Number 1 Region: 118-215
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.79e-23
Family B3 DNA binding domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 59689.Al_scaffold_0008_2296
Sequence length 267
Comment (Arabidopsis lyrata)
Sequence
MAYEEARKLRLQENHKRFQLNFAALPQFQLLQQRNPRPIDKALFATAEPRRSSRVRTVIS
SYRDDVAVDTGRTSNLRRSRHSSTWATYISRPLHECKFASYEEKVGALNAAEKFQSRLKS
PHPSFVKSMVRSHVYSCFWLGLPSRFCVDNFPEETMEIVLEDEEGEEYEAVYIGRRSGLS
GGWKRFALDHKLDDGDALLFQLVEPKRFKIYVFKGNENANLTSAGKRGRATSEEEEEDKD
VEESCDDEHSSRATKRPSARLLRKRKA
Download sequence
Identical sequences D7MPM5
59689.Al_scaffold_0008_2296 jgi|Araly1|886032|Al_scaffold_0008_2296 XP_002864560.1.15461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]