SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 59689.fgenesh1_pg.C_scaffold_3002399 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59689.fgenesh1_pg.C_scaffold_3002399
Domain Number 1 Region: 575-669
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-22
Family B3 DNA binding domain 0.00082
Further Details:      
 
Weak hits

Sequence:  59689.fgenesh1_pg.C_scaffold_3002399
Domain Number - Region: 358-477
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0575
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 59689.fgenesh1_pg.C_scaffold_3002399
Sequence length 725
Comment (Arabidopsis lyrata)
Sequence
MKSLHVAANGEDLAEDCGILAGDADDTALMDGMDEVGREIWLDDHGGDHNHVHVHSHEDD
DLIVHHDPSIFYGDLPTLPDFPCMSSSSSSSTSPAPVNAIVSSASSSSAASSSTSSAASW
AILRSDGEDPTPNQNQYASGNCDDSSGALQSTGSMEIPLDNSQGFGCGEGGGDCIDMMET
FGYMDLLDSNEFFDTSAIFSQDDDTQNPNLMDQTLERQQDQVVVPMLEKNSGGDMQMMNS
SLEQDDDLATVFLEWLKNNKETVSAEDLRKVKIKKATIESAARRLGGGKEAMKQLLKLIL
EWVQTNHLQRRRTTTNNNNNFSYQQSFQQDPFQNPNPNNNNLIPPSDQTCFSPSTWVPPP
PPQQAFVSDPGFGYMPAPNYPPPGEFLPLLESPPSWPPPPPPPQSGPMPHQQFAMPPNTQ
YNQFGEPTGFTGYNMNPYQYPYVPAGQVRDQRLLRLCSSATKEARKKRMARQRRFLSHHH
RHNNNNNNNQQNQTQIGETCAAVAPQLNPVATTATGGTWMYWPNVPAAPPPQLPPAMETQ
LPTMDRAGSLAAMPRQQAVPDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKKEAET
HLPELEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVKTNGLQEGDFIV
IYSDVKCGKYLIRGVKVRQPTGQKPEAPPSSAAATKRQNKSQRNINNNSPSANVVVASPT
SQTVK
Download sequence
Identical sequences D7L571
59689.fgenesh1_pg.C_scaffold_3002399 jgi|Araly1|342636|fgenesh1_pg.C_scaffold_3002399 XP_002883542.1.15461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]