SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 59689.fgenesh1_pg.C_scaffold_5000680 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59689.fgenesh1_pg.C_scaffold_5000680
Domain Number 1 Region: 97-206
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000118
Family B3 DNA binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 59689.fgenesh1_pg.C_scaffold_5000680
Sequence length 224
Comment (Arabidopsis lyrata)
Sequence
MKMPLFSALKTQQYLSTTSSENPKKCLVSTTLCLSSCENPNKRKMNTNDDPKVSCRPSDE
KSTNEERKIKRMRNLSNEEKAEEEWYGVSTELTLFKDPWIIKKELTNSDLGQLSRLLLHT
GPIEDHIIKYLNNDDKNNVQQGLGITVDVYDHDTDSTFELILKRWTTLNSYVLNGGWRMY
FIRRRGLRKGDQIGLFWDRFASRLHFRVLSRASTEVFVDEKNPN
Download sequence
Identical sequences D7LNU1
jgi|Araly1|347288|fgenesh1_pg.C_scaffold_5000680 59689.fgenesh1_pg.C_scaffold_5000680 XP_002875493.1.15461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]