SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 59689.fgenesh1_pm.C_scaffold_1000456 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59689.fgenesh1_pm.C_scaffold_1000456
Domain Number 1 Region: 192-314
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000114
Family B3 DNA binding domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 59689.fgenesh1_pm.C_scaffold_1000456
Sequence length 340
Comment (Arabidopsis lyrata)
Sequence
MTTIDDDHTAERNKMGSTSELYELAGVKATLNDAEQRARKGKAKIVSKEEDNVFIKKKKD
DDEESEKKKFFSHVPRKIRPALRYPQPNFENPNGASTSSSSPCSSTLPFGNYIPDEYKKT
EMKNPSNTNHQWSPYPWLTEYTNPTEVREMLQRRSSGGFKKPKVTFFPRRTWGMPWWQFQ
VMRDMNGEDLTLILEKTLSKSDVNPTLGRLLMPFNSLIRNEFLTPEERSIIEEDIDNDDD
EKMEVGAILVDPRFEKWGVVLKKWEVGNHSGNVSWNYCLTCGWNDVVKANDLKDGDNIGV
WAFRCGGVLCFALMPWNPMFALVPPLTLRQSSSSNALRLC
Download sequence
Identical sequences D7KF94
59689.fgenesh1_pm.C_scaffold_1000456 jgi|Araly1|311676|fgenesh1_pm.C_scaffold_1000456 XP_002889578.1.15461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]