SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 59689.fgenesh1_pm.C_scaffold_4001155 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59689.fgenesh1_pm.C_scaffold_4001155
Domain Number 1 Region: 198-310
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000392
Family B3 DNA binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 59689.fgenesh1_pm.C_scaffold_4001155
Sequence length 324
Comment (Arabidopsis lyrata)
Sequence
MPHQPLPFSASNTQYLFYGKSSENPKKSLVSTTLCLSSCENPKKRKMNSDDDLKVSCIPS
DYKLTKVERKIARMRNLTNEERALDEWYGVSTELTLFKDPWIIKKVFHFSSIMDMHPINT
LCLLDAVESSENPEESLVSLDLCLYDRTWPHDPNVAYNKPTSGEKMNLAWMRTKSNEARK
EEERYNVSTELTLLTVTDPWTLKKVMTKCSLGHLKRLVLKESFVHIHILRYLPVDDQMMV
QEGSGLTVDVYDHDTDSTYKLLLKKWAKYPRFVLINGWHTCFVTRRGLKKGDVIGMYWDR
SESKIHFCVLSRAPMDSAPLPPST
Download sequence
Identical sequences D7LGD2
59689.fgenesh1_pm.C_scaffold_4001155 XP_002879467.1.15461 jgi|Araly1|321098|fgenesh1_pm.C_scaffold_4001155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]