SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 59689.fgenesh1_pm.C_scaffold_4001762 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59689.fgenesh1_pm.C_scaffold_4001762
Domain Number 1 Region: 62-166
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000569
Family B3 DNA binding domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 59689.fgenesh1_pm.C_scaffold_4001762
Sequence length 189
Comment (Arabidopsis lyrata)
Sequence
MDVTPDEAEVSLALLLLGQYPVFFEKEEEEEEESVSEDELEVKISNQTYEKKGKKKRKVA
EQLTGSDVKDNQCRLMLGKEQVKKMMVDVLGKAEKLGIHGQKVSVYGPKGEIHEMVFKMW
KKDTPILMSVGWKNFVKKYKLEKHVDFLTIWMFRHKETRKICFAIDSTRIPVKGMLSPKI
LNAAFKNPS
Download sequence
Identical sequences D7LEF9
jgi|Araly1|321705|fgenesh1_pm.C_scaffold_4001762 59689.fgenesh1_pm.C_scaffold_4001762 XP_002879847.1.15461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]