SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 59689.fgenesh2_kg.1__3340__AT1G32030.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59689.fgenesh2_kg.1__3340__AT1G32030.1
Domain Number 1 Region: 195-311
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000235
Family B3 DNA binding domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 59689.fgenesh2_kg.1__3340__AT1G32030.1
Sequence length 324
Comment (Arabidopsis lyrata)
Sequence
MPTYYNDHLAAAEKDISSSKFCNLVDASVMLYEEKHRKLLPKKVKSRGHAKKKKKQEKES
DKRFFHLFPKRRRTSVVTVRNPEQNQQNLDRVSTSSSLLDLNTIPDDSSDPRNPLQGLSS
SSSSCLGADNKRKTPQNPPSSSTLLVEYNTEMTNPPNPKYESTKKAKVAPYSWIGKEAPE
WLVKMMGTMQGSEGPRLIYQKTLTETDIKPDQSRLLVPFNTLICNDFLTPVESRILLEED
DTKGVGATLVDPWEVKWGVILKKRKMKKNSGKVTLNYAIICGWNEIIEANVLEEGDDISI
WSFRRGRNGILCFALVLPPPPDMA
Download sequence
Identical sequences D7KHE7
59689.fgenesh2_kg.1__3340__AT1G32030.1 XP_002890961.1.15461 jgi|Araly1|473386|fgenesh2_kg.1__3340__AT1G32030.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]