SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 6085.XP_002163798 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6085.XP_002163798
Domain Number 1 Region: 333-515
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.83e-31
Family cAMP-binding domain 0.0085
Further Details:      
 
Domain Number 2 Region: 146-326
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000000262
Family Voltage-gated potassium channels 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6085.XP_002163798
Sequence length 656
Comment (Hydra magnipapillata)
Sequence
MEDSNENRFLETIIEKAKDIGGLFIIASSVTLNRSILYCSVQFSEKIKLLRTVVLKKNAY
LDFLFGKQTNILSIKRYKEAIDLNKKENVEMVLYDASELDSPKTKWRNIARRVMMISFYE
EMFIPFYGREKVKLPEYVISQDHILKKCWDSFMLFIKVYTAIVLPFSICFKKYPKILNAF
DTVFDIAFLVDIGLTFFTTYVDKKGVLVTDLKKIKSDYLKGWYLIGFQIDVVVKQNSHGW
LSYLMSIEYSYSGANATTLIADGKGPPILDCYITALYFVVTILSTCGFGNSGNDASTLTE
KMFTIIAMVLGCVLYAFIFGKVNNIIAQLYHATNEYSAQLNAIKHFIKTYKVPNSIGSRL
KDYFIATWTVTKGVNQEKIMNRYPRDLQSDLCLCIHKKVFEKETCFKNMSKEAQRSVSRY
FWVLRTPPGDILVSYCEMVDSIYFVISGAFEVNCNEELIGLIGPGDSFGQRLVSKPEKST
CEVKSTSYGIVHSINVDGLLKALAIFPEELDKMKYTLKLSVDITKKIQKDRYKVKEVILN
NWVGSKSNLIDISFEAENHDDSKSILKPGSSLNVKMQKQPKELNKKVAQKTFDVKTKSVA
TKTQTKDARNVINKKFNKVTPELANHPIELENNSNELICFRNNTDKFFFANGDSSV
Download sequence
Identical sequences 6085.XP_002163798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]