SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 6238.CBG05789 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6238.CBG05789
Domain Number 1 Region: 301-404
Classification Level Classification E-value
Superfamily PapD-like 0.00000000000000419
Family MSP-like 0.0043
Further Details:      
 
Domain Number 2 Region: 91-160,188-236
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.000008
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 6238.CBG05789
Sequence length 414
Comment (Caenorhabditis briggsae)
Sequence
MDLISTINQESCMKYVVVRWKNLENGIQFSNTELFHFLMSIDYDVLDSIFHLHTTDSESA
ILLKLANEKDVMQLCMDSELLESGFFVNRLIDLNGIRLQVPEREKIAEEELKIIENGISE
LVENAVFTIFGSYNSKVRRNGFSDIDLAVSSRSSDRTDVRPVDMIIENPKCLLEHPLSHA
EFYSYPPEEVIRAIYKCFLDNEVFQNRFKMRAHLVETPIVMLDSTKVPEMKKFHVKGDTE
VSKKGDLPIASTANKVQESPEDKKISQQGSVKKETSVQNPEFKKDDGKSQRTEKNEKNKK
PLISVEPFGDLTFKVESESQIRLTFKNISEEKIMFKIKVSDQAYTSFVFSVNPVFGTLEA
GESSDVVVTHFSSPCKEAKLVTVNSKYVGEIDLAKSFRNAKPTGGPVTINLIAN
Download sequence
Identical sequences A8X1M4
CBG05789 6238.CBG05789 XP_002633099.1.8413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]