SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 6239.M106.5.2 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6239.M106.5.2
Domain Number 1 Region: 3-268
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.4e-90
Family Capz beta-1 subunit 0.0000000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 6239.M106.5.2
Sequence length 270
Comment (Caenorhabditis elegans)
Sequence
MGEQQLDCALDLMRRLPPQHCDKNLTDLIDLCPHLVDDLLSTIDQPLKIAADRETGKQYL
LCDYNRDGDSYRSPWSNTYDPPLEDGQLPSEKRRKMEIEANAAFESYRDLYFEGGVSSVY
FWDLDNGGFAGIVLIKKEGDGAKNITGCWDSIHVIEITERARQAHYKLTSTIMLWLQTNK
SSSGVMNLGGSLTRQHEMDAPINDQNTHLANMGRMIEDQESKMRLTINEIYFGKTKKVMS
DLRSTEKQSELEKQDEIVRELNNAMANRGN
Download sequence
Identical sequences P34686
M106.5 6239.M106.5.2 M106.5.1 NP_496336.1.50509 1312 CAA79270 M106.5 WR178 CE01608___KOG3174 M106.5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]