SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 62977.ACIAD1040 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  62977.ACIAD1040
Domain Number 1 Region: 3-304
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.55e-110
Family Glutaminase 0.00000192
Further Details:      
 
Domain Number 2 Region: 325-420
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000053
Family Anti-sigma factor antagonist SpoIIaa 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 62977.ACIAD1040
Sequence length 421
Comment (Acinetobacter sp ADP1)
Sequence
MQTPVPEYLAHVIDQCENNQTGKLADYIPELAHANPDQVALAMSTVDGQIYAVGDEDIEF
TIQSMSKPFTYAYVLQQLGLDEVLDKVGVEPSGEAFNEISLGHDKRPKNPMINSGAITTH
SLIPIKDQLESAEIIRRFMSELAGRELCFDEAVYASEIKTAYRNLSIGYMLRTVGILETD
PVDIVNGYIRQCSILVTVKDLVKMGSILANGGIDATTGKRLLNRDVVRQVLSVMMSCGMY
DAAGDWLTTVGIPAKSGVAGGILGVLPGQVSIAAFSPRLDEHGNSVRGIEMMERLSRDMG
LHLMEGTPSAQTIVQSHYRTGKNASTSIYVLRGVLKFTEAEMLLRIFQGEAVDESTIVID
LTQISLIHDVGKRMFLEGVDRLIDDGHSVLLVDPEQRLEQARTHKDRVLHVYQNMDELLE
K
Download sequence
Identical sequences A0A2D7VE38 Q6FDC8
gi|50084242|ref|YP_045752.1| WP_004921713.1.43955 WP_004921713.1.60904 WP_004921713.1.84452 WP_004921713.1.9579 WP_004921713.1.98780 62977.ACIAD1040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]