SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 634499.EpC_02260 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  634499.EpC_02260
Domain Number - Region: 32-135
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0575
Family Apolipoprotein 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 634499.EpC_02260
Sequence length 179
Comment (Erwinia pyrifoliae Ep1 96)
Sequence
MFDIGFSELVLVFIIGLVVLGPQRLPVAVRTVMGWIRALRSLATSVQNELAQELKFQELQ
DGLKKIEQVSKDNLSPELKASVEELKQTANSMKRSYLSENEKADDEAHTIRNPLQKDAQE
AHDGVTPAQADLQADAPAQAPVTVTQKASSEPQPDIKQEPPAPVAPRASVTSTPPSDER
Download sequence
Identical sequences D2TCU0
gi|259906907|ref|YP_002647263.1| 634499.EpC_02260 WP_012666607.1.53124 WP_012666607.1.74942 gi|387869617|ref|YP_005800987.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]