SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 634499.EpC_18840 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  634499.EpC_18840
Domain Number 1 Region: 20-100
Classification Level Classification E-value
Superfamily Apolipoprotein 0.000000000589
Family Apolipoprotein 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 634499.EpC_18840
Sequence length 126
Comment (Erwinia pyrifoliae Ep1 96)
Sequence
MQQEIRLTPSCDDMTAIKLSQQEIKRDIHELRKEVKEDTGALRQEVKQDISALRQEVKQD
FEALRTEVKQDIGALHQGMNNDMSHLRQDMYRLQQHARTDFRLLFGALISLAIGMSGLVA
KAFNWI
Download sequence
Identical sequences D2TBI1
WP_012668188.1.53124 WP_012668188.1.74942 gi|387871408|ref|YP_005802782.1| gi|259908534|ref|YP_002648890.1| 634499.EpC_18840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]