SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 63737.Npun_BF231 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  63737.Npun_BF231
Domain Number 1 Region: 5-189
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 7.98e-57
Family Methylesterase CheB, C-terminal domain 0.0000445
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 63737.Npun_BF231
Sequence length 336
Comment (Nostoc punctiforme PCC 73102)
Sequence
MLEHNIIVIGTSAGGVEALTYLVKHLPPDLKAAVIIVLHVSNHGTSVLPKILSRAGNLPA
SHAQDGEAIIHGRIYIAPPDYHLLVESVYLRLTRGPKENRHRPAIDTLFRSAARSYGQRA
IAVLLTGMLDDGTAGLVAIKMRGGVAIVQNPDDALHPDMPRNAIENVLDIDYIQPLSDIP
STLVALVNTPMKVEPENPIPDKMEFESSIVQLDLEAVKNEADRPGKPSIFGCPDCGGILW
ELEEGNLLRFRCRTGHAFSAETLLATQSDKVEDALWIAFRALEEKASLSHRMALRMEEHN
QALAAKRFKEQAESAWQHSAIIREILLKADTSTGVD
Download sequence
Identical sequences B2JBP3
gi|186687245|ref|YP_001870388.1|NC_010632 WP_012413351.1.44837 63737.Npun_BF231 gi|186687245|ref|YP_001870388.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]