SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 63737.Npun_F0262 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  63737.Npun_F0262
Domain Number 1 Region: 19-203
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 5.75e-63
Family Methylesterase CheB, C-terminal domain 0.0000382
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 63737.Npun_F0262
Sequence length 208
Comment (Nostoc punctiforme PCC 73102)
Sequence
MIQMAEDAKNNPPHFTNAGFDIVAIAASAGGLTAQIKVLSTLPAEFPAAIAIVQHISPEH
PSFMAEILSRRTDITVKQAQEGDDLSPGTAYIAPPNRHLLVNDDGTLSLSQSKLVHFLRP
SADLLFESVAATYKERAIAIVLTGTGSDGAMGVEAIKKMGGTVIVQDLKTAEFSGMPSAA
IQTGNVDFILPLDEISRVLVSLVMGKCN
Download sequence
Identical sequences B2J4S5
63737.Npun_F0262 gi|186680794|ref|YP_001863990.1| WP_012407074.1.44837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]