SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 63737.Npun_F6361 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  63737.Npun_F6361
Domain Number 1 Region: 1-211
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.69e-62
Family Phosphate binding protein-like 0.0000251
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 63737.Npun_F6361
Sequence length 214
Comment (Nostoc punctiforme PCC 73102)
Sequence
MLTVALPKGELLKNSIRLLQSVGLDFSAFLDSGTRQLQIPDTKGLAKALLVRAQDVPVYV
EYGQAQLGVVGYDVLREKQPQVAHLVDLQFGYCRMSVAVKASSSYRSPLDLPPHGRVASK
YVNCAREYFHSLDLPVEIVPLYGSVELGPITGMSEAIVDLVSTGRTMRENGLIEIATLYE
STARLIAHPLSYRMNTGNLSDVIAKLREAVLVEV
Download sequence
Identical sequences B2IY34
WP_012412572.1.44837 63737.Npun_F6361 gi|186686380|ref|YP_001869576.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]