SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 64471.sync_0305 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  64471.sync_0305
Domain Number 1 Region: 51-149
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 4.71e-27
Family Pentapeptide repeats 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 64471.sync_0305
Sequence length 157
Comment (Synechococcus CC9311)
Sequence
MTFLLKRIWCAFGSMALVLGPSAVEAGSVTAIAVEPFGTPLERLLESGACQGCDLRDADL
RGRHLIGADLRDADLRGAQLSGVNLEGADLSGARLDGARLQGAMLSNADLSDSDLRHADL
RDSVVINAYAPGVQTEGMQFAGSDLTGSHLIYGGGPD
Download sequence
Identical sequences Q0IDD3
64471.sync_0305 gi|113953553|ref|YP_729539.1| WP_011618284.1.57161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]