SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 64471.sync_0546 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  64471.sync_0546
Domain Number 1 Region: 118-221
Classification Level Classification E-value
Superfamily Cell-division inhibitor MinC, C-terminal domain 4.45e-30
Family Cell-division inhibitor MinC, C-terminal domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 64471.sync_0546
Sequence length 237
Comment (Synechococcus CC9311)
Sequence
MITSVALTQGTFQTACHRLVLPTNRHIPWQDTLADQLNGLEGKDLELDSGEWLLNCRVLA
AFQAQLEERQCRLLSIKSCNPHTVVSANALGIPAQLMTPQPTDPRPESREEQQAPALLIH
RATLRSGDHLKARHHVLLIGDVNPGAQISAGGNVLIWGRLRGCAHAGVQGDLNARITALQ
LRPLQLRIADLVARGPEEKPQPGLAEEARIVDGEIAIEPADPRSDLTIQELSFDLNN
Download sequence
Identical sequences Q0ICQ1
64471.sync_0546 WP_011618501.1.57161 gi|113952750|ref|YP_729771.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]