SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 64471.sync_0793 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  64471.sync_0793
Domain Number 1 Region: 169-305
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 1.98e-38
Family ATP-dependent riboflavin kinase-like 0.0006
Further Details:      
 
Domain Number 2 Region: 14-173
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 7.39e-25
Family Adenylyltransferase 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 64471.sync_0793
Sequence length 309
Comment (Synechococcus CC9311)
Sequence
MIHLCSPQQAKTPTTLALGSFDGLHAGHRRVISSVTETDHLHAIPTVVSFWPHPREVLHG
EPRLRLDLPEEKLELLEPLSIQQLVLVPFNRQLAQLSAADFVEQVLLGCLKARQIAVGAN
FRFGRGRKGDTNTLRALAEAAGVQVSVLPILEDAEGRMSSSRIREALSNGDLQTASALLG
RPYRFRGTVVRGRGLGRDLGWPTANLQVDGRKFLPGLGVYAARAWTQRDGEALPAVMNLG
PQPTVDPNSPSAVEVHLLDRRIELVGQELVVEPVERLRGQQRFSGLDELSAQIGQDADAA
RQRLQAAAG
Download sequence
Identical sequences Q0IC15
64471.sync_0793 WP_011618734.1.57161 gi|113954373|ref|YP_730007.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]