SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 645127.ckrop_1275 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  645127.ckrop_1275
Domain Number 1 Region: 2-320
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 7.46e-77
Family ATP synthase (F1-ATPase), gamma subunit 0.0000278
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 645127.ckrop_1275
Sequence length 327
Comment (Corynebacterium kroppenstedtii DSM 44385)
Sequence
MATLRELRDRIKSVNSTKKITKAQELIATSKITKAQARVAASQPYAEEITKVVHRLSSAS
SLDHPMLREREGGNRAAILVVSSDRGMCGGYNHNVFKKVAELRALLEKQGYEVVLYVFGN
KGLTYYRFRGEALEGAWTGYSQDPEYEGTHQMRRHLIDAFVASSSGKAEWRPGLTAPEGE
SVQGFDQLHVVYTKFESMLSQKAVARQMLPMEAVIDYEEVETGEDMLSDPDDSEISANYE
FEPDATTLLSELLPHYVSRALYALLLESAASESAARRTAMSSATDNATELATTLSRTANQ
ARQAQITQEITEIVGGAGALDDSGESD
Download sequence
Identical sequences C4LJL5
WP_012731907.1.74818 645127.ckrop_1275 gi|237785858|ref|YP_002906563.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]