SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 67593.JGI135067 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  67593.JGI135067
Domain Number 1 Region: 349-541
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.24e-37
Family cAMP-binding domain 0.00056
Further Details:      
 
Domain Number 2 Region: 124-275
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000573
Family Voltage-gated potassium channels 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 67593.JGI135067
Sequence length 782
Comment (Phytophthora sojae)
Sequence
MFRRKPVKALVVAGDAEDDTEATILEAGGEETEAPTPTQVAQQEPTAVPTTVPVTKKLLG
RLNKRDSKVQATPDAANTPRRSNTWSRSTGSLLRLASDNATINVLRMSLFEMQDRVSYRW
VLHPQSPLKTSWDLMSAFIVVYYSWIIPFMLCFDWYVPSHTTNVFMKVLDVWGFLDIALR
LRTGIIEYGAVIMNPRKIRKAYIRSIWFPIDIASSFPFEYFINDTSTSVSTRKTIKMIKY
IKLPRLLRLGRFVKYLKRYKRYSSVTISLNTVVFSAHVAGYAIEATRPHCQDGGEMDVYW
VAFHHGMVSLLGVSATHVEASDRFLSGGYNHSSSDDINSSVYLWSVALKKMDHVTHEMDA
LSLPKPLRARVTAYYDYLWLNNRALSEQLNLLHDPGMSLTLRRQIAIYLFKDNLQKIPFF
QLATDAVLGMICMQLHQVIYMPDDFIIQEGEIGKELFMIVKGIVRVLPPKKCKKPQDETI
ILLSQGDFFGEIGVVMEVERTRSVKAECMAELCVLAREGFDKILVEFPEFATAMKKLIVK
RVGEMWKDEGPERMEKMTALADAKMKKTIQAYKNMEKLRNKTRALANFRPRLSNLLSTSD
ALTPHNLRGDQGSGRASDEIVAAAAAAAAAVAVTSENASAASATIPNKTPLGPITEDSLV
DEGKTPPETSRYNSISDLAHAVGEQFNNPASDATAVLGVHVADRRPERGAVHPVARSTAA
TQQLQQLEAQLRLVEQKMETKMADLDNKLEQILRHLAPAKPNALPPIASPPISFRRDPSF
QQ
Download sequence
Identical sequences jgi|Physo1_1|135067|estExt_fgenesh1_pg.C_350119 67593.JGI135067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]