SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 67593.JGI137202 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  67593.JGI137202
Domain Number 1 Region: 242-435
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.59e-42
Family cAMP-binding domain 0.00063
Further Details:      
 
Domain Number 2 Region: 82-186
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000267
Family Voltage-gated potassium channels 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 67593.JGI137202
Sequence length 606
Comment (Phytophthora sojae)
Sequence
MGKGWNLVKGATSAPAADGVTTTVPPGEYHLGKAGRLWLAALGGARAEVVPASNRVSLKV
AEQERLIRLARSNHTHKYMLLPDSMFRYCWDLLLAITTILLIWRVPYTIAFGESELWYWY
AFNKITDAIYLLDVVLNFRTGYVEDTEIVMDSRLVAKHYIQSWFFVDLIGSIPVEYIISA
NTAGFSGVERKAFKASVKYLKVPVVTVEPKWQFLSAVLGVVGFLFQCLTLASITAGVIGS
SSRALQYQEKVRMVMSDLKALHVPGELRKATKNYYETLWRMKNTSDRYEKAIYEDEDLSP
ALRAEIALYIHRNLIATVPLFQGCSDSCLAACVMRLKTQLCMRGDVVFHKGDPANSMVII
SRGKVKVISPDNEGLLAVLKAGSFFGEIGLLRHMTRSCTVIAGTFCELKSLDRNDAEEIF
EAYPHIHDRLFAEAEKRRLDTRLKERLYNVKVLDNAHAVDVSSIVEVPGSGGKNNQPFVH
GASEEKHPAAPMSSSGSGSKPFRLVRGNSFQTEDGIAVNSELDTMNINLDEILRLVETLK
ATQGRLSRVQERRQSIHMALNSPTPINSINSVLFTQAPARPDSRASTRNRESLHSVNRSG
NRSGNS
Download sequence
Identical sequences 67593.JGI137202 jgi|Physo1_1|137202|estExt_fgenesh1_pg.C_510086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]