SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 67593.JGI139038 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  67593.JGI139038
Domain Number 1 Region: 520-647,726-783
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.94e-34
Family cAMP-binding domain 0.0006
Further Details:      
 
Domain Number 2 Region: 390-556
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000129
Family Voltage-gated potassium channels 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 67593.JGI139038
Sequence length 1053
Comment (Phytophthora sojae)
Sequence
MADETSTDVEVMTPDLSKEEFSTASTSWQNEPDVLLARFKSNVRIARRHSTQLAPGVVYP
IPEGTGEAAPNGTIGQARRLLRRSSTLRGLTPTSKPWAPMLAGISRAGASLKAYNDNTED
AKEAICETPYEEMMMRFQIRQIQRTASGTVVRADDRRGSAGSSRSPETDTAGRINSPENT
HDNPMDQPNHEEVPDQLRAQPRLSSLQTSERLSSSYDAPVVDGASHASTVPPLGGRFASF
PSRQVNFAAARAIEQPDPWRDLRESIIDLLRVWIDMVLTPFTPFSGFSQVRYLMVLLVTT
TYVVFFPLGFAFPDVEQFTLHTSFMQPDGTIVTSHREIARHYLKTRFVVDALLTIPLVAH
VDNKAGRKFGGTWLHLFLDILSAERLAFFARFVRMIWLMRLNQSGSGNSFWAWLLYSRYS
HLLRIAGIVTMLVGIAHYIACVWNVLLEKGGDLSDESASWQEQYSASFYSALLLLQGEAV
PTDTAGQNLFASLSVLVGSIVLAVIFGHVAILVSNFNANFTNYQRKMEAVFAMTAKLQLP
PSLRERIHEYYEHLWHEYECLDGEIVQFSKELSHTLGLEVVLFKYMELVMHVPFWKDCTP
DFQKQLILRLDVRVYLPNDFIMREGEVDDEFYMVNRGYCELSRALHRFERISNTMIGMRR
TSSTPGFNTSRSQGGLTGRSNGGMTGRRRYSGLTGVSLNDGHRQSAYELDPAQRRYYSST
GRRTARAYEIMITRGQAFGDLALLMNYQRAANVRAITHVEMCVLSRDNFQAVLTKYPDDR
RRVVVDMLTSYMQSYEMTHSRCPLLELVRKVYSAEAIAEACAKAGSAPPLLPPVLTARQA
AERVYTAINLETNDATLKFGIGANIREQLIDLRERRRQKRQTQRHPRSILGQSARNLVQK
TGGDVRDRRTSEHTSDITERDSVTATIDPPPQEPAPVLQTPQAQSGLSWQERLQQIEERE
VVILRALQDLQTSFTLLQARQATQSAPAPRAATRPPLGGPSPSSELGSAQNLPSRKRSLP
EKEIPTPESAAVTRPRLLQRMGSLWIPNLSSKK
Download sequence
Identical sequences 67593.JGI139038 jgi|Physo1_1|139038|estExt_fgenesh1_pg.C_690047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]