SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 67593.JGI139256 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  67593.JGI139256
Domain Number 1 Region: 337-444,556-617
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.84e-27
Family cAMP-binding domain 0.0022
Further Details:      
 
Domain Number 2 Region: 86-323
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000149
Family Voltage-gated potassium channels 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 67593.JGI139256
Sequence length 1051
Comment (Phytophthora sojae)
Sequence
MKAKDESHEEMMQRFQLRRLSSDRGSPSKFGRGKNLVIDKATGIKRRKTRRLTLQRLLRK
FTSSKSRRKALRGLTSPITPTSWTSTVHGIVLFMVYHFQLLYLPFSPSYYPNGPVHSTLA
QFALETVFLVDLLLNFNTAFVRQGVLITSRSEIAQNICKWFAFDLLSALPLQAIHCVLSR
SLDGTNSSIHGVQLTLMGLRLLRVTIFERGVLLSRVMRVANHIAEWLRYSRYSHLLGIAQ
LMWLVLLIAHYMACFWHVVTTESNANANANGALSQKQSVLEHLIQGQGGSFGTWGENLYS
SVAIIVGSVILAIVFGNVAMLVSNFNANTTNYHRKMEALRERVNEYYTHVWLEYEALDGN
INKFQQELTHTLRIEIGLYKFMNLVVKIPFWEDCTPDFLTQIVLSLGVRVYMPDDYVVRR
REIGSEMMMINLGYCKLSKPMKHNEDKPSRGPTVADFSDDAEKPLLMPEDLGSPEQQEAE
EGSDDDEWDDTSSDEDSDDDLSSDPFGSPAAIRRMSGSVFELQCGDGDNSMAEIKTDRPR
RHSNPSSVEILDRPKKFRVYLNPGTAFGEMSLLMNYKRQANVRPVTFVEMCVLDRCTFQR
IISRYPEDRRRVLTRMLQSCIEKKEIPFPWENIIEAVCAKRRVSGKKDISRASVIATMTA
AEAARILVEAIDVNVPDDTIKYGFQSFDQQFVNEPALRHAHSVGAKIREALQRTHSGLRE
TLQRTNSGLREPLQRSNSGLPDTLLRANSGLREPLQRSNSGVVPFRTYSRRNSSADSGRS
SSTAELTEPESDTSGVSAQSTGSTEKTLESVMRLMHTLVENISRLQQDVTELKARGASFG
GCCCNSANPWCARRKLLWLMQQSNTKLNRLVGPDSPACREGSSSSKRGETMARRDSSNLD
ACRGIIYSGRSSQRPSQYELKRGNSTMKVTPRVDLPAGGSAEMEDSPAQQIVVDPYAEPQ
PGKLSTRSKSGRQSTLADMLWKRSNTNVDLLRRSSASKMHQKLKSRHSLPAGVAVTATNT
ESEMPPIPDEADGPAETSQLEAPSSPPTLAS
Download sequence
Identical sequences jgi|Physo1_1|139256|estExt_fgenesh1_pg.C_720022 67593.JGI139256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]